الأبحاث العلمية

أنت هنا

The Role of Accounting & Auditing Profession in Achieving the Economic Development in Sudan احمد يوسف آدم إسماعيل
This study aims to shed light on the role of Accounting& Auditing Profession in Realizing Economic Development in Sudan from Auditors and Academics point of view. The study focused on the role which could be played by the accounting profession towards achieving social and economic development, and tries to come out with some proposals which could participate in solving the problems which impede the practical application of accounting profession. The data has been collected through a well-structured questionnaire that designed and distributed to a randomly chosen sample of who working in auditing field. Descriptive and inferential statistics were used to generalize the results and conclude the findings. The weakness of educational level for accounting users negatively affects the development of the accounting profession. The contribution of the accounting profession in development in Sudan depend on advanced accounting practices. Keywords: accounting profession, auditing profession; economic development, accounting practices, accounting users ...
The Role of Forensic accounting in Decreasing Risk of Financial Misstatements from Sudanese Academics Prospective احمد يوسف آدم إسماعيل
The financial corruption represents the biggest danger facing societies in general and the financial meltdowns of some of the companies increased the spread of this phenomenon which has a negative impact on the confidence of the financial report.The aim of this study is to explore the role a forensic accountant can play in the fight against financial misstatements by applying his investigative skills and providing litigation support service. The data has been collected through a well-structured questionnaire is designed and will be distributed to a randomly chosen sample of who working in the accounting field. Descriptive and inferential statistics were used to generalize the results and conclude the findings. The results suggest that forensic accounting contributes to the availability of reliable financial reports. Also shows the application of forensic accounting in Sudan provides a transparent increase the value of corporate financial reports. Application of forensic accounting adds value to the company through securing and protecting owners' interest against fraud and financial fraud. Keywords: forensic accounting, reliability, Financial Reporting, financial misstatements, company value. ...
The Relationship between the Education of Forensic Accounting & Accounting Students Competence in Sudanese Universities احمد يوسف آدم إسماعيل
Forensic accountant plays a significant role in decreasing risk of financial & managerial misstatement in companies. The purpose of this study is to investigate the link between the education of (FA) & accounting students competence with reference to Sudanese universities. In order to achieve this aim, Descriptive and inferential statistics were used to conclude the findings. Statistical package for the social sciences (SPSS) was used to analyze data and test hypotheses. The results of the study indicate that the inclusion of (FA) topics within the curriculum of the accounting department in Sudanese universities developed the characteristics and skills required for a forensic accountant. Also, the study concludes that the studying of (FA) increase the ability to detect the financial misstatement disputes in the future. The study recommends that there is a necessity for the Coordination between the academic & professional bodies on how to develop the (FA) in the Sudanese environment. Keywords: Forensic Accounting; Accounting Education; Accounting Curriculum; Financial Misstatements, Accounting Students; Competence Accountant. ...
The Relationship between Accounting Education & Accounting practice. with reference to Academics and Practitioners of Accounting Profession in Sudan احمد يوسف آدم إسماعيل

The effectiveness of accounting profession depends widely on the best accounting education outputs. The aim of this study is to examine the relationship between accounting education and accounting practice with particular reference to Academics and Practitioners of Accounting Profession in Sudan. The data has been collected through a well-structured questionnaire is designed and will be distributed to a randomly chosen sample of some practitioners of accounting and auditing profession in Sudan. Descriptive and inferential statistics were used to generalize the results and conclude the findings. The results suggest that accounting practice is declined because the accounting courses at Sudanese universities not compatible with labor market needs, also shows that role of the accounting profession in Society depends on the best coordination between accounting education, accounting research and labor market needs.

Keywords: accounting education, accounting practice, accounting research, auditing profession, qualified Accounta.

...
The Impact of Economic factors on the Development of the accounting practice in Sudan احمد يوسف آدم إسماعيل
Abstract: The reliable financial information plays an important role in the decision-making process and economic development. This study aims to shed light on the impact of economic factors on the development of accounting practice in Sudan. The data has been collected through a well-structured questionnaire that designed and distributed to a randomly chosen sample of who working in accounting & auditing field. Descriptive and inferential statistics were used to generalize the results and conclude the findings: There is a role of accounting information in achieving the economic development and economic growth, however, the contribution of the accounting profession toward the development in Sudan depend on advanced accounting and removing barriers (inflation, financial crisis, country intervention & Economic instability) that faced the accounting practice in the Sudanese environment. Also, the study found that there is a positive relationship between economic progress and the development of the accounting profession especially when there is an economic instability. Keywords: Accounting profession, economic factors, accounting practice, economic, Auditing, development, inflation ...
.The impact of Accounting and Audit Profession Ethics on the Reliability of Financial Reports with reference to Sudanese auditor احمد يوسف آدم إسماعيل
The reliable financial information plays an important role in economic and social development. The aim of this study is to examine the impact of accounting and auditing profession ethics on the reliability of financial reporting with particular reference to Sudanese auditors. The data has been collected through a well-structured questionnaire is designed and will be distributed to a randomly chosen sample of who working in auditing field. Descriptive and inferential statistics were used to generalize the results and conclude the findings. The results suggested that existence of accounting and auditing profession ethics guidance renders legal and compulsory guides with clear punishments contributes in rendering data with credibility, also shown that there is a great importance for teaching accounting and auditing profession ethics for the accounting and auditing students. Keywords: Profession ethics, reliability, Financial Reporting, accounting Standards, Integrity. ...
The Impact of Creative Accounting Techniques on the Reliability of Financial Reporting with Particular Reference to Saudi Auditors and Academics احمد يوسف آدم إسماعيل
Creative accounting plays a significant role in financial reporting but it has been negatively correlated that means more managers involved in it may decrease the value of financial information, this study aims to shed light on the impact of creative accounting ethics techniques on the reliability of financial reporting from auditors and academics point of view. The data has been collected through a well-structured questionnaire is designed and will be distributed to a randomly chosen sample of certified auditors and accounting instructors in some universities. Descriptive and inferential statistics were used to generalize the results and conclude the findings. The result deduces that creative accounting techniques used by management negatively affect the reliability of financial reporting. The statutory auditor plays an important role in promoting creative accounting practice in such way that .positively affect the reliability of financial reporting. ...
The effect of e-banking orientation on customer service quality - KSA banks customers’ perspective محمد صالح يوسف علي

The study searches to test e-customer service quality toward e-banking orientation. The target sample was drawn from Saudi Arabian e-banks customers by using questionnaire survey. A total of 160 usable questionnaires were conducted. The results show that there is a positive significant relationship between e-banking orientation and e-service responsiveness, e-service security/privacy, and e-service reliability. Therefore, results of this research confirm the strong evidence that customer service quality can be impacted by e-banking orientation in Saudi Arabian e-banks. For practical implications: when effectively used as a resource for creating competitive advantages through simultaneous competitor orientation, customer orientation, and strategic orientation, can lead Saudi Arabian banks to provide high levels of service quality to customers and build proper reputation with regards to their reliability activities, security activities, and responsiveness activities in the market environment. Additionally, the findings of this study might be generalized for other Saudi Arabian financial institutions e-service quality. Finally, the findings highlight significant relationships to test in future researches concentrating on different industries.

...
The Effect Of Applying And Practicing Communication Skills In Promoting Organizational Performance An Application On Neelain University– Sudan عبدالواحد ادم فضل الله
Research conducted to identify the effect of applying and practicing communication skills in promoting the organizational performance in (Neelain University –Sudan). Research determined the relation, association and effect of communication skills (speaking, reading, listening, and writing skills) in promoting organizational performance. Total sample size of research is 39 (members of teaching staff and employees) from the university. The questionnaire was used for collecting the data, which has been analyzed by using SPSS program. Research examined that there is a relationship between the communication skills and organizational performance. The research examined that the communication skills (speaking, reading, listening, and writing skills) are positively related to the organizational performance. Also research concluded that the application and practicing of effective communication skills have positive role in promoting the organizational performance. ...
The effect of scientific level in good time management عبدالواحد ادم فضل الله

Research conducted to identify the effect of scientific level in good time management. in the faculty of science and humanity studies (university of Salman bin Abdulaziz- branch of Aflaj) . Research determined the relation, association and effect of scientific level (teaching assistant, lecturer, assistant professor, associate, and professor) in good time management. Total sample size of research is 46 members of teaching staff from the faculty. SPSS was used to analyze the data. Research applied chi- squared or (x²) and regression analysis, to examine the hypotheses. Research examined that there is a relationship between the scientific level (degrees) and the good time management. The research examined that the scientific level is positively related to the good time management. Also research concluded that the use of computer and media technology have moral impact on good time management among employees in the faculty.

...
THE EFFECT OF APPLYING THE ECONOMIC ORDER QUANTITY MODEL IN THE FIELD OF INVENTORY عبدالواحد ادم فضل الله
Research conducted to identify the effect of applying the economic order quantity (EOQ) model as a scientific method in the field of inventory. Research determined the relation, association and effect of applying the economic order quantity model in the field of inventory, in the factory of Asalaya (White Nile State – SUDAN). Research applied (T) Test and examined that there is a moral difference between the average annual costs (M2) by following the traditional method and the average annual costs (M1) by following the economic order quantity model as a scientific method in the field of inventory. The research concluded that using and applying the economic order quantity model as a scientific method has always an effect in the field of inventory. ...
The Effect of Applying Managerial Skills in the Field of Management (An Application on Sudanese Universities in Khartoum) عبدالواحد ادم فضل الله
Research conducted to identify the effect of applying the managerial skills in the field of management,(the administrative and organizational aspects- social aspects- civilization and cultural aspects),in the Sudanese universities in Khartoum. Total sample size of research is 60 employees (members of teaching staff and workers) from the Sudanese universities in Khartoum. SPSS (Statistical Package for Social Sciences) was used to analyze the data. Research applied (t) test distribution analysis. Research concluded that, results of axis one (1) and (3) combined together supported the hypothesis of the study that the (Sudanese universities enjoy effective application of managerial skills). Research also examined that Results of axis two (2) of the study, reflect aspects need to be activated to better exploitation of the potential and resources available. ...
Impact of Job Satisfaction on Employees Performance an Application on Faculty of Science and Humanity Studies University of Salman Bin Abdul-Aziz-Al Aflaj عبدالواحد ادم فضل الله
Research conducted to identify the impact of job satisfaction factors on employee`s performance (employee's impressions, inclinations, desires, and visualizations towards their jobs) in the faculty of science and humanity studies (university of Salman bin Abdul-Aziz-Aflaj branch). Research determined the relation, association and impact of job satisfaction factors and its dimensions on employee`s performance in the faculty. Total sample size of research is 86 members of teaching staff from the faculty (male =46 and female =40). SPSS was used to analyze the data. Research applied chi- squared or (x²) and regression analysis. Research examined that there is a positive and statistically significant relationship between job satisfaction factors and employee's performance. The research concluded that whenever there are better (work conditions, pay and promotion, and work relationships) there is a higher job satisfaction. ...
DESIGNING A SYSTEM FOR VERIFICATION PROCESS OF INDIVIDUAL IDENTIFICATION IN STUDENT PICK UP MANAGEMENT SYSTEM – APPLICATION ON ELEMEN-TARY SCHOOLS عبدالواحد ادم فضل الله

Security is one of the necessities of daily life for individuals and societies. Each system or organization seeks to increase the level of security in order to protect per-sonnel and its properties. In this paper, we designed a full system for SPMS and we focused on the verification process only because of its importance and being considered as a pivot of the whole system. We focus on one of the important people in the society, who are elementary school students, especially when the students dismiss the school in the releas-ing time, and who is going to take them home after school. From this point, we try to suggest solutions by making mechanism for student’s dismissal.

...
Challenges Facing Quality Application in Higher Education Institutions in Sudan عبدالواحد ادم فضل الله
This paper aims to review the main challenges which are facing quality application in higher education institutions and universities in Sudan. These challenges became as obstacles, in ensuring the quality of the output of the educational process, so as to achieve the objectives of sustainable development, and meet the needs and requirements of labor market, locally and internationally. So the paper has stated the constraints and challenges in these institutions and provided some suggestions to deal with them. ...
ابحاث في البلاك بورد د/ فاطمه كمال النجار

--

...
بحث اثرائي في التنمية المستدامة د/ فاطمه كمال النجار
ﺩﻭﺭ المؤسسات التربوية في ﻣﻮﺍﺟﻬﺔ ﺑﻌﺾ ﻣﻈﺎﻫﺮ ﺍﻟﻌﻮ لمة ﻣﻦ ﻣﻨﻈﻮﺭ التربية ﺍﻹﺳﻼﻣﻴﺔ د/ فاطمه كمال النجار
اشكالية التنمية المستدامة وأبعادها د/ فاطمه كمال النجار
"استخدام التحليل العاملي التمييزي لقياس مدى فاعلية التعليم الإلكتروني المدمج والمساند في جامعة الأمير سطام بن عبد العزيز كلية العلوم والدراسات الانسانية بالأفلاج فرع الطالبات" افراح يحي الرزامي

(1-1) المقدمة:

إن تطبيق التعليم الإلكتروني بأنواعه المختلفة  يحتاج إلى وجود صفات معينة يجب أن تتوفر في الاساتذة و الطلاب والبنية التحتية للجامعة، وأن السعي إلى توفير هذه الصفات تسعى اليها معظم  الجامعات. وجامعة الأمير سطام  بن عبد العزيز دأبت خلال السنوات الماضية على الاهتمام بالبنية التحتية المتمثلة في بناء شبكة داخلية وتزويد مكاتب أعضاء هيئة التدريس بأجهزة الكمبيوتر، بالإضافة إلى توفير دورات تدريبية للأساتذة، كل ذلك يفترض أن يحقق عائدا مجزيا على العملية التعليمية، و إحداث تطوير نوعي في أساليب التدريس، ومن هنا جاءت فكرة هذا البحث لتسليط الضوء على العوامل المؤثرة على مدى فاعلية التعليم الإلكتروني المدمج والمساند، باستخدام تقنية التحليل العاملي التمييزي الذي يعد من الأساليب الإحصائية المتقدمة، على اعتبار أن هناك العديد من الدراسات السابقة التي تناولت الأساليب الإحصائية التقليدية، مع ندرة الدراسات التي تناولت أسلوب التحليل العاملي التمييزي في مجال التعليم الإلكتروني.

الملخص :

تسعى الدراسة الحالية الى الاستفادة من تقنية التحليل العاملي التمييزي ((DFA لقياس مدى فاعلية التعليم الإلكتروني المدمج والمساند في تدريس المقررات الدراسية في كلية العلوم والدراسات الانسانية بالأفلاج جامعة الأمير سطام بن عبد العزيز، من خلال استطلاع اراء الطالبات، حيث تم تصميم استبيان كأداة لجمع البيانات بالاعتماد على أربعة محاور( ثقافة التعليم الإلكتروني ، تطبيق التعليم الإلكتروني، الفائدة من تطبيق التعليم الإلكتروني، معوقات التعليم الإلكتروني ) بالإضافة الى المتغيرات الثنائية، و أظهرت النتائج أن :

1.     النموذج الملائم لتمثيل دالة التمييز هو النموذج الخطي.

2.     استخلاص (10) متغيرات من بين (28) متغير لها القدرة على التمييز بين اقسام الكلية.

3.     دالة التمييز الأولى تكفي لتفسير التباين...

" استخدام الاختبارات الغير معلميه لقياس مستوى جودة الخدمات و الأنشطة الطلابية وأثرها على رضا الطالب" دراسة تطبيقية على طلبة كليـة التجارة والاقتصاد بجامعة صنعاء (2012 م - 2013 م ) افراح يحي الرزامي

المـقدمــة

          نعلم أن البرامج الجاهزة المستخدمة في التحليل الإحصائي لا تساعد الباحث في اختيار التحليل المناسب للبيانات تلقائياً، بل تترك هذ المشكلة لخبرة وتمكن مستخدم الحزم الإحصائية الجاهزة. ومهما كان نوع الدراسة ( إنسانية أو طبية أو زراعية أو هندسية أوغيرها )، فإنها تستلزم استخدام الأساليب الإحصائية لتحليل البيانات واختبار صحة الفرضيات والتوصل إلى النتائج. وغالباً ما يتم الحصول على البيانات من خلال الاستبيانات (بيانات ترتيبية)، ويكون التحليل الملائم لمثل هذه البيانات هو استخدام الاختبارات الغير معلمية. وعندما يتغاضى  مستخدم الحزم الإحصائية عن تحقق شروط الاختبارات المعلمية فإن النتائج التي سيحصل عليها ستكون غير دقيقة. و من هنا كانت عمليه اختيار التحليل الإحصائي المناسب ضرورية لصحة نتائج أي تحليل إحصائي.

        إن تحليل الوضع الراهن لجامعة صنعاء بالاعتماد على نتائج دقيقة وواقعية يعد من المتطلبات الضرورية التي تساعد الجامعة على حل مشكلاتها والتفكير في الرؤية المستقبلية لها. وعلى وجهه الخصوص نجد أن الكثافة الطلابية في كلية التجارة و الاقتصاد بجامعة صنعاء  صاحبتها أوجه قصور تمثلت  في عدم الاهتمام بالخدمات والأنشطة الطلابية، مما جعل الباحثة تختار هذه الكلية كحالة تطبيقية لموضوع الدراسة.

وفي هذا البحث تم استخدام الاختبارات الغير معلمية (Non-Parametric) باعتماد  اختبار الإشارة و توزيع ذات الحدين (Sign Test and Binomial Distribution) لاختبار الفرضية الأولى، وكذلك استخدام الاختبارات المعلمية (Parametric Tests) باعتماد  اختبارT لعينة واحدة (One Sample T test) لاختبار نفس الفرضية، ومن ثم مقارنة النتائج. وأيضاً تم استخدام اختبار كروس كال – والاسKruskal – Wallis)  ) لاختبار الفرضية الثانية، حيث تم جمع البيانات من خلال استبيان يقيس مستوى جودة الخدمات والأنشطة الطلابية وتأثيرها على...

تطبيق للمشي العشوائي لماركوف علي نظام الغسيل الكلوي منصور فتحي ياسين علي
          An Application of Markov Random Walk  to   a Dialysis System 

...
On certain classes of meromorphically multivalent functions associated with the generalized hypergeometric function منصور فتحي ياسين علي

Making use of a linear operator, which is defined here by means of the Hadamard product  (or convolution), involving the generalized hypergeometric function, we introduce two novel subclasses p;q;s._1I A; B; _/ and C p;q;s._1I A; B; _/ of meromorphically multivalent functions of order _ .0 _ _ < p/ in the punctured disc U_. In this paper we investigate the various important properties and characteristics of these subclasses of meromorphically

...
Majorization for Some Classes of Analytic Functions Associated with the Srivastava-Attiya Operator منصور فتحي ياسين علي

In the present paper, we investigate the majorization properties for some classes of analytic functions associated with Srivastava-Attiya operator. Moreover, some applications of the main result are obtained which give a number of interesting results.

...
Stakeholder competencies intelligence-scale development and validation Some Evidence from KSA Journal of Leadership, Accountability and Ethics 2016 Volume 13(1). P 116-131 ISSN 1913-8059 North American Business Press. Accepted: Dec 08, 2015 محمد صالح يوسف علي

Sustainable bank's continuing success and improvement depend heavily upon the competency of stakeholders’ relationships with the others environment chain ends. The purpose of the study is to develop operationally and theoretically measures to the construct stakeholder competency intelligence on banking industry. Depending on the literature review, a fifteen items scale was developed for testing. The academics and practitioners viewpoint was invited. The new scale development steps were conducted. The goodness of measure was used. The statistics analysis results are above the acceptable levels and no, systematic response bias was found. The study contribution is a new scale development and validation.

...
The Difficulties Arising When Translating from Arabic to English حسن بن شايع آل حزيم

Since there are different, variant and multiple definitions of “translation” and what is meant by it, a number of challenges and hindrances have emerged, requiring translators from one language to another to overcome them by recognising the root of the problems and providing solutions to them. However translation is defined, that definition is going to shape and affect how a SL text is going to be dealt with in order to convey the intended meaning or message into a TL text. These problems range from variable aspect, whether they are syntactic-based, semantic-based, pragmatic-based or cultural-based. To increase the concentration of this essay, we are going to narrow it down to two languages: Arabic and English.

...
Effect of the phase damping of two qubits on both the quantumdiscord and non-local correlation عبدالباسط عبدالحميد محمد

are investigated. The qubits are initially in Werner states and the field in coherent state. Under the influence ofthe damping, the geometric measure of quantum discord (GMQD) and the measurement-induced nonlo-cality (MIN) are investigated. GMQD and MIN are compared and illustrated their different characteristics.It is found that under the influence of damping the phenomenon of the death occurs for GMQD, but this phenomenon does not occur for MIN even when the damping parameter is high. The initial conditionsfor the qubits play an important role in the phenomenon of collapses and revivals for GMQD and MIN.

...
Non-classical effects in cavity QED containing a nonlinear optical medium and a quantum well: Entanglement and non-Gaussanity عبدالباسط عبدالحميد محمد
medium and a quantum well. It is shown that the dynamical behavior of the entanglement and the non-classicality are very sensitive to the initial state and the optical nonlinearities. By filling the cavity with the optical nonlinear medium, the non-Gaussianity as well as the light-matter entanglement is enhanced. For certain parameter sets, it is possible to control the degree and the dynamics of these quantum effects. ...
Bipartite non-local correlations in a doublequantum- dot excitonic system عبدالباسط عبدالحميد محمد
measurementinduced non-locality (MIN) and Bell non-locality, are investigated in a system of two coupled quantum dots (QDs) entangled through their interaction with a cavity mode, including Förster and exciton–phonon interactions. When the two QDs are situated very close to and symmetrically about the antinode of the sustained longitudinal mode, the violation of Bellʼs inequality only occurs with strong MIN and QE. If one of the QDs is located very near to the node while the other one is located slightly far away from the node, the violation does not occur even with strong MIN and QE. When both QDs are located in the cavity in such a way that they see different cavity field amplitudes, the violation occurs with weak or strong MIN and QE. The generalized Rabi frequency acts as a control for the occurrence of these different types of the quantum correlation in the system, with MIN more general than the conventionally mentioned quantum non-locality related to the QE or violation of Bellʼs inequalities. ...
Efficient protocol of N-bit discrete quantum Fourier transform via transmon qubits coupled to a resonator عبدالباسط عبدالحميد محمد
 Based on the one- and two-qubit gates defined and generated via superconducting transmon qubits homogeneously coupled to a superconducting stripline resonator, we present a new physical protocol for implementing an N-bit discrete quantum Fourier transform. We propose and illustrate a detailed experimental feasibility for realizing the algorithm. The average fidelity is computed to prove the success of this algorithm. Estimated time for implementing the protocol using the proposed scheme is compared with previous schemes. Estimates show that the protocol can be successfully implemented within the present experimental limits. ...
Wehrl entropy information and purity of aSCcharge qubit interacting with alossy cavity field عبدالباسط عبدالحميد محمد
A systemofasuperconductingchargequbitwithgatechange nea12 interactingwithasingle-mode microwavecavity field, coupledtoitsreservoir,isintroduced.Thesystemistransformedintotheusual Jaynes–Cummings modelbycanonicaltransformation.Analyticalandnumericalresultsundercertain parametric conditionsareobtainedbymeansofwhichweanalyzetheinfluence ofthedampingterms and thedetuningonthedynamicsofWehrlentropyandpuritylossofthestates.Theresultsindicatethe sensitivity oftheseaspectstochangeeitherinthedecayorinthedetuningparameters.Aninteresting relation betweenthecorrelationanddecoherenceeffectisobserved. ...
Quantum correlationsoftwonon-interactingion's internalelectronic stateswithintrinsicdecoherence عبدالباسط عبدالحميد محمد
Two non-interactingtrapped-ions,withintrinsicdecoherence,arelocatedintwosetsofspatially separatedcavities.Thequantumcorrelations,ofthetwononinteractingion's internalelectronicstates, are investigatedbyusinggeometricquantumdiscord(GQD),measurement-inducednonlocality(MIN) and quantumentanglement(QE).Theinfluence ofboththeintrinsicdecoherenceandmeanphoton number onthecorrelations,withresonantoroff-resonantcase,isdiscussed.Thecorrelationsappear periodically whenintrinsicdecoherenceisneglected,however,theintrinsicdecoherencecausesthe decay ofcorrelations.Itsincreaseleadstoquickdisappearforthecorrelations.ItisfoundthatBell violation andGQD,MINandQEdonotsatisfythemonotonousrelation.Also,GQDandMINaremore robust thanQEunderthephasedecoherence,buttheycanbedecreasedbyadjustingthedetuning. ...
How to learn English prepositions? Said Ahmed Aboudaif

This file teaches how to learn English prepositions

...
study on the relationships among marketing information system quality and brand equity management in banking sector محمد صالح يوسف علي

study on the relationships among marketing information system quality and brand equity management in banking sector 

Journal: Asain Business Review 2015 vol5/3 pp 119-126

...
THE APPLICATION OF SFLS TO SACRED TEXT Qur’anic Verses as an Example حسن بن شايع آل حزيم

In order to expand the circle of research in written discourse, an attempt to apply Systemic Functional Linguistics to a sacred text has been an interest. It is worth examining that type of texts using the aforementioned approach and validating its application, whether it would prove beneficial or not. I have chosen some Qur’anic verses in particular to exemplify one type of holy texts and test the SFLs approach.

Systemic Functional Linguistics, abbreviated as SFLs, is an approach to linguistics that considers language as a social semiotic system. Michael Halliday, who took the notion of system from his teacher, J. R. Firth, developed it. SFLs consists of two features, they are 1) systemic, in that it considers language as a network of interrelated systems or set of choices for expressing meaning, and 2) functional, which deals with what language does and how language works, giving language’s structure less attention (Halliday, 1977), which is the focus of other theoretical schools, i.e. Generative School.

...
THE ISSUES INVOLVED IN THE TRANSLATION OF SLANG AND SWEARING INTO SUBTITLES حسن بن شايع آل حزيم

With the revolution of digital era, Audio-Visual Translation (AVT) has gained increasing audienceall over the world. Its two most common forms, i.e. subtitling & dubbing, have been the centre of heated discussions and study. The task of audiovisual translator has been viewed as challenging and demanding because it is very much replete with varieties of linguistic, technical, semiotic, cultural problems and so forth (Thawabteh, 2011). For this reason, the amount of plausible audiovisual translation difficulties is limitless and a list that would account for each one of them can never be finite (Karamitroglou, 2000), and the original text’s aestheticswill be lost (Tytler, 1790).
This essay discusses one of the difficulties that faces the translator; subtitling swear and slang words, with some connection to Arabic subtitling issues.

...
IS EQUIVALENCE IN TRANSLATION MERELY AN IDEALISTIC CONCEPT حسن بن شايع آل حزيم

In this essay, it will be argued whether equivalence in translation is achievable or not. It will include a section about the equivalence theory and how it has been present in the field of translation studies and developed by some key linguists and translators, such as Vinay and Darbelnet, Jakobson, Nida & Taber, and Baker. Giving the nature of language, culture and translation process, they are subject to different factors that can change and alter meaning of messages intended to be conveyed. For that reason, the validity of the equivalence theory will be tested against some cultural expressions to see whether it can assist in transferring of the meaning from the Source Language into the Target Language (Arabic and English) and how it deals with other translation issues, e.g. lack of equivalent.

Before delving into the equivalence theory, there will be a brief look at translation and what it means, and some key differences between English and Arabic.

...
Translation: Does Practice Inform Theory or Does Theory Inform Practice حسن بن شايع آل حزيم

Since that time when language was divided and every division formed a new linguistic system for communication between different people, there has been a need for translation. It has been practiced throughout ages to convey a message from one side to the other. Therefore, dedicated translators who learned different languages were in demand. Since then, translation has undergone series of complex processes in order to better convey the intended message and transfer it across targeted languages. Those processes have shaped into a range of different conditions; theory and practice. This essay tries to draw a line between theory and practice and to see the relationship between them.

...
أحكام القيام عبدالمجيد إبراهيم الخرعان

يهدف البحث إلى بيان شمولية هذا الدين لاحتوائه على جميع ما يحتاجه  المسلم في أمور دينه ودنياه ، مع تبصير العباد بما يلحقهم من جهل في عباداتهم ، ومعاملاتهم، وسائر شؤون حياتهم، كما يهدف إلى جمع المسائل الفقهية المتفرقة في أبوب الفقه ، المتعلقة بموضوع القيام في بحث مستقل ودراستها من أبواب العبادات والمعاملات وأحكام الأسرة والآداب والمناسبات.

...
DESIGNING A SYSTEM FOR VERIFICATION PROCESS OF INDIVIDUAL IDENTIFICATION IN STUDENT PICK UP MANAGEMENT SYSTEM – APPLICATION ON ELEMEN-TARY SCHOOLS مزمل موسى سعيد موسى

Security is one of the necessities of daily life for individuals and societies. Each system or organization seeks to increase the level of security in order to protect personnel and its properties. In this paper, we designed a full system for SPMS and we focused on the verification process only because of its importance and being considered as a pivot of the whole system. We focus on one of the important people in the society, who are elementary school students, especially when the students dismiss the school in the releasing time, and who is going to take them home after school. From this point, we try to suggest solutions by making mechanism for student’s dismissal.

...
The Moderating Effect of System Quality Management on the Relationship between Organizational Knowledge Based and Retention Equity in Banking Industry محمد صالح يوسف علي

International journal of multidisciplinary and current research

volume3 march/april issue year 2015

...
The impact of marketing orientation quality on relationshipship equity محمد صالح يوسف علي

International journal of management, IT and Engineering

Volume5 issue4 year 2015

...
M. Arar, A Note on Spaces with a Countable -Base, Acta Mathematica Hungarica, 144(2) (2014), 494-498. مراد مصطفى عرار

In topological spaces every normal space with a countable base is metacompact. We show that this is not necessarily true in generalized topological spaces; more exactly we give an example of a mu-normal space with a countable mu-base which has a mu-open cover with no mu-open point-finite refinement.

...
Murad Arar, A Counter Example in Generalized Topological Spaces, Journal of Advanced Studies in topology, 5(2) (2014), pp 44-46. مراد مصطفى عرار

In this note, we give a counter example to show that in [4, Theorem 5.4] is not true. Precisely: We show that there exists a nonempty countable mu-compact T2-space X such that every point of X is a mu-cluster point of X, and X has a non-empty nested collection of mu-open sets.

...
M. Arar & H. Hdeib, Strongly Paracompact Mappings, Italian Journal of Pure an Applied Math., 31(2013), pp177-186. مراد مصطفى عرار

In this paper, we define and study strongly paracompact mappings which
are the fibrewise topological analogues of strongly paracompact spaces. Several charac-
terizations and properties of strongly paractompact mappings are obtained.

...
Designing a Cache Memory Simulator using Pic microcontroller مزمل موسى سعيد موسى

Processors are generally able to perform operations on operands faster than the access time of large capacity main memory. Though semiconductor memory which can operate at speeds comparable with the operation of the processor exists, it is not economical to provide all the main memory with very high speed semiconductor memory. The problem can be alleviated by introducing a small block of high speed memory called a cache between the main memory and the processor.

This paper aims to design and implement the cache memory, using the PIC microcontroller. It is designed to give students the ability to monitor cache systems behavior and determine the various cache systems performance.

Cache designing system must be able to show the following results:

• Number of hits: Which are referred to the number of times and indicate that the data were found in the cache.

•Number of misses: which are referred to the number of times and indicate that the data were not found in the cache.

• Hit ratio: Which is equaling  (number of hits/ (number of hits number of misses)).

...
Gaps of Cryptography and their Automatic Treatments with Reference to classical Cryptography Methods مزمل موسى سعيد موسى

The subject of security in the automatic information system is highly considered as an interesting subject in the view of researchers and workers who are dealing with those systems. The world wide spreads of computers have had direct impact on the development and efficiency of automatic information system. But still there is a continuous fear towards the security aspects and possibility of dependency of computers in directing and handling the automatic systems in permanent image and minute, and its ability to protect secrets and privacy from assault and snooping. The main objective of this paper is the exposure to gaps of coding systems with focus on classical encryption methods , designing  mechanisms and scientific methods, to help in  raising the security efficiency , and to provide the entire protection for data by using different methods with a special focusing on sensitive data.

...
دليل الاستشهادات العربي - مشروع تخرج أحمد عبدالله المنصور

بما أنه لا يوجد دليل استشهادات عربي، هذا المشروع يهدف لدراسة إمكانية بناء وعمل دليل استشهادات للمواد المنشورة باللغة العربية، وبعدها سيقوم هذا المشروع بإنشاء نموذج تجريبي لهذا الدليل، هذا المشروع مهم جداً للباحثين في مختلف المجالات ليساعدهم في عمل أبحاثهم في المواد العربية وإيجاد المواد الأكثر استشهاداً في مجالات بحثهم، كما يتيح لهم التصفح في شجرة الاستشهادات صعوداً ونزولاً، هذه التقنية مفيدة جداً للباحثين أكثر من الطريقة التقليدية التي تعتمد على الكلمات المفتاحية.

...
ON SUBCLASSES OF UNIVALENT FUNCTIONS WITH NEGATIVE COEFFICIENTS IV منصور فتحي ياسين علي

Abstract. The object of the present paper is to obtain closure theorems and integral operators of functions in the classes S*(a, β, μ) and C*(a, β, μ)(0< a< 1, 0< β< 1, 0< μ< 1) consisting of analytic and univalent functions with negative coefficients.

Furthermore, some

...
Medical image Enhancement Application Using histogram equalization in Computational Libraries مزمل موسى سعيد موسى

This paper gives the simple guideline to perform histogram equalization to enhance the Medical images without using the function histeq () in MATLAB. Medical images are one of the fundamental images, because they are used in more sensitive field which is a medical field. The main goal of this study is to improve features and gain better characteristics of medical images for a right diagnosis.

����� Medical images were usually poor quality especially in contrast. For solving this problem , we proposed Histogram Equalization which is one of the techniques in a computer image processing domain.

...
Security Defects in Identification Systems which depends on Biometrics and the Mechanisms of repairing مزمل موسى سعيد موسى

Biometrics is one of the evolving technologies widely used in different aspects of life today. The use of biometrics for identification is a system mainly established to recognize a certain person through authentication by using a set of biological characteristics. In this paper, I aim to survey the security risks and defects in identity verification systems that are based on biometrics, and try to suggest risk management solutions in order to increase the security factor whenever using such systems.

...
• Designing of a flexible Algorithm system for the statistical processing of students' grades مزمل موسى سعيد موسى

      This paper aims to take advantage of advanced information and communications technology (ICT) to make the teaching and learning process electronic with the purpose of meeting the challenges of the twenty first century, threats and future issues in order to ensure the continuity of survival. Such an objective is targeted through the design of a flexible algorithm system for processing student results statistically. This system will work out the statistical treatment according to the model adopted by the Examiners or the educational institution. In addition, such a system presents some standard models and recommends their use.

...
• The role of E-learning in facing the challenges of the century مزمل موسى سعيد موسى

The aims of this paper is to clarify the concepts and basic advantages of E-learning and try to find the best definition of E-learning to applied  in Sudan. Therefore,  the vision of the use of information and communications technology in making the teaching and learning process electronic able to face the challenges of the century and the issues of the future. In order to ensure the continuity of survival, the paper shows the new roles of the student, curriculum and teacher. It  has found the need to build a plan for E-learning depending on the framework of the Sudanese consistent with the evidence consists of five components, namely management, information and communications technology, education, ethics, education and assessment.

...
• Apparent causers for the academic declination of students in university level compared with secondary level An application on Computer Science & Information Technology-Al Neelain University مزمل موسى سعيد موسى

The aims of this paper is to study the causes of academic declination of students in university level compared with secondary level, taking the students of Computer Science & Information Technology-Al Neelain University (batch 2012) as sample using SPSS and its outputs to help decision makers to determine best resolution for  the phenomena .

...
General Characteristics of Software Development Companies in Sudan and its Impact on Production, مزمل موسى سعيد موسى

This paper aims to study the characteristics of Software Development Companies in Sudan (private companies) in terms of company size, financial ability, and years of experience in the field of Software Development. The researcher also tries to check out the qualifications of the staff involved in the process of Software Development in order to place these Companies among the large Companies working in the same field. To achieve this, a questionnaire was designed and the data collected was statistically analyzed through Statistical Package for Social sciences (SPSS) and the results were discussed and the findings were set accordingly.

...
The Use of GIS in knowing the effect of road traffic accidents مزمل موسى سعيد موسى

         The aim of this paper is to study the problem of transport accidents and traffic game in central Khartoum by using Geographical Information System(GIS) technology for radical solutions for the problem through designing  computerize model to assist decision makers to choose the best roads planning decisions to camps with  international standards in respect to area, passes separation and  constructing circular  roads beside proposed roads in study area.

...
Application the concepts of spatial interpolation using GIS and Google Earth in building a three-dimensional map - applied on the state of Khartoum " مزمل موسى سعيد موسى

This paper aims at reflecting Google Earth and Geographical Information System (GIS) software in constructing the Contours Maps. It also explains the three dimensional Maps (Contours Maps), considered as the main core of the well- organized  planning that  required to be based upon. Moreover, the three dimensional maps also help in supporting the future strategic decisions for achieving the goals of the permanent development.   

...
The relationship between information system quality and customer equity management -services sector محمد صالح يوسف علي

                   Asian Pacific Journal of Marketing Management Review March 2014 Vol3 No3 PP24-37

...
Conjugate duality for a class of multiobjective optimization problem ربيع أحمد الزين

Using the conjugate duality concept in the sense of convex analysis, we give a characterization of the solution of the Multi-objective optimization problem. This paper is considered as generalization of the paper [4] in which we use the transformation to the single-criterion before giving a characterization of the solution.

...
Sub-differential approach for solving the multiobjective optimization Problem, approximation by the interior-point algorithm" ربيع أحمد الزين
Using the sub-differential concept in the sense of convex analysis, we give a characterization of the solution of the multi-objective optimization problem. Formulations of our initial problem in various practical forms are explored. Some numerical examples, illustrating the theoretical study and showing the interest of the used approach, are discussed. ...
Multicriteria optimization approach of the electricity distribution planning network problem ربيع أحمد الزين
The management of electricity distribution networks raises many problems in Society, mainly due to network expansion, increased consumption of electricity and real-time management. This is due to the continued growth in demand for electricity, posing more challenges for Society. As the strengthening of electricity networks is difficult and expensive simultaneously, it is necessary to choose an optimal process management ensuring customer satisfaction, reducing costs and increasing margins profit. In this paper, we present a multicriteria decision support methods to make appropriate choices in the planning and the operating of such networks without omitting of any of the main objectives. ...
Valuation of wind generation of electrical energy by integrating a system of storage hydro-electric ربيع أحمد الزين
Wind generation of electricity is a logistics business that has a major economic and social impact. In Morocco, there are only insignificant and inadequate resources used to support economic development that the Kingdom has experienced lately. In this context, wind energy could play an important role in the energy sector. This work is to enhance the production of wind turbines in meeting demand and keeping the rest of available energy in the form of potential energy for a subsequent application. This study examines the logistics of wind electricity generation. Initially, an overview of literature is made. Next, a description of various characteristics and constraints of problem is raised. Finally, one gives implementation of operating policies for the definition of a strategy to follow. ...
Approaching a class of Multicriteria Optimization Problem via the Schur-Convexity ربيع أحمد الزين
In the present paper, we would like to explore the Shur-convexity notion for investigating the optimal solution of a class of multi-criteria optimization problems. Some numerical examples illustrating the theoretical study and showing the interest of our approach are discussed. ...
Approaches solving petrol stations supply networks ربيع أحمد الزين

The distribution of petroleum products is a logistics business which has a major economic impact. In Morocco, there are hundreds of service stations in the network distribution of gasoline and fuel. This study examines the logistics of supply service stations. Initially, a description of various characteristics and constraints of the problem arises. Then, an overview of literature is performed and finally, there is presentation of approaches to solving the problem which is a strategic element of industrial infrastructure.

...
Outils d'aide à la décision pour la planification des réseaux de distribution de l'énergie électrique ربيع أحمد الزين

The continued growth in demand for electricity is a increasingly challenge for the company. This requires great efforts to optimize decisions to be taken especially for managing the distribution of electricity which poses many problems in society, primarily due to the expansion of the network, increased consumption Power and real-time management. As the strengthening of electrical networks is difficult and expensive at the same time, it is necessary to choose an optimal management to ensure customer satisfaction, reduce costs and increase profit margins. In this work, we propose a few different optimization methods to solve partially or globally this problem, allowing to make appropriate choices.

...
أثر تحديد الاحتياجات التدريبية التربوية على تنمية وتطوير الموارد البشرية في قطاع التعليم بمحافظة وادي الدواسر أنس عبدالباسط عباس

أثر تحديد الاحتياجات التدريبية التربوية على تنمية وتطوير الموارد البشرية في قطاع التعليم بمحافظة وادي الدواسر. مجلة كلية التجارة – جامعة المنوفية – العدد الثالث والرابع – 2012م.

...
تخطيط وتنمية المسار الوظيفي للعاملين وانعكاساته على التطوير التنظيمي في المنظمات العامة أنس عبدالباسط عباس

تخطيط وتنمية المسار الوظيفي للعاملين وانعكاساته على التطوير التنظيمي في المنظمات العامة (دراسة ميدانية) مجلة الباحث الجامعي – جامعة إب- العدد 27 – اكتوبر/ ديسمبر – 2011 م.

...
متطلبات قيام الحكومة الالكترونية بالتركيز على الموارد البشرية أنس عبدالباسط عباس

متطلبات قيام الحكومة الالكترونية بالتركيز على الموارد البشرية (دراسة تطبيقية لعينة من الوزارات في الجمهورية اليمنية) مجلة شؤون العصر –  المركز اليمني للدراسات الإستراتيجية - العدد السادس والثلاثون- (يناير - مارس) 2010 م.

...
واقع تخطيط الموارد البشرية وفاعلية تحقيق الأهداف في المنظمات التربوية أنس عبدالباسط عباس

واقع تخطيط الموارد البشرية وفاعلية تحقيق الأهداف في المنظمات التربوية ( دراسة ميدانية في مديرية التربية بمحافظة حلب ) مجلة الإداري / متخصصة في العلوم الإدارية / معهد الإدارة العامة - سلطنة عُمان العدد 119 – السنة الحادية والثلاثون 1431هـ 2009م .

...
- الرقابة على أنشطة التجارة الالكترونية بالتركيز على الرقابة الإدارية أنس عبدالباسط عباس

- الرقابة على أنشطة التجارة الالكترونية بالتركيز على الرقابة الإدارية ( دراسة ميدانية في البنوك اليمنية بمحافظة الحديدة ) مجلة الباحث الجامعي – جامعة إب – العدد عشرون – مارس – 2009م .

...
- الحوافز وأثرها على الأداء ( دراسة ميدانية ) أنس عبدالباسط عباس

- الحوافز وأثرها على الأداء ( دراسة ميدانية ) مجلة تنمية الرافدين - جامعة الموصل – العراق– العدد 93 - 2009م.

...
- الاستقطاب الوظيفي وأثره على دوران العمل في المنظمات الصناعية اليمنية أنس عبدالباسط عباس

- الاستقطاب الوظيفي وأثره على دوران العمل في المنظمات الصناعية اليمنية - دراسة ميدانية – مجلة العلوم الإدارية والاقتصادية – كلية التجارة والاقتصاد – جامعة الحديدة المجلد الأول - العدد الأول محرم 1430 هـ - يناير 2009م .

...
الصحة والسلامة المهنية في الشركات الصناعية اليمنية ( دراسة ميدانية) أنس عبدالباسط عباس

الصحة والسلامة المهنية في الشركات الصناعية اليمنية ( دراسة ميدانية) مجلة البلقاء للبحوث والدراسات – جامعة عمان الأهلية – الأردن – المجلد (12) العدد (2) شعبان 1429 هـ - آب 2008.

...
تخطيط الموارد البشرية مفتاح البلوغ للأهداف في المنظمات أنس عبدالباسط عباس

تخطيط الموارد البشرية مفتاح البلوغ للأهداف في المنظمات ( دراسة ميدانية ) مجلة شؤون العصر –  المركز اليمني للدراسات الإستراتيجية السنة الحادية عشرة - العدد الرابع والعشرون- (يناير - مارس ) 2007 .

...
الرقابة الإدارية وأثرها على بلوغ الأهداف ( دراسة تطبيقية ) على البنوك الإسلامية في اليمن أنس عبدالباسط عباس

الرقابة الإدارية وأثرها على بلوغ الأهداف ( دراسة تطبيقية ) على البنوك الإسلامية في اليمن – المركز اليمني للدراسات الإستراتيجية السنة العاشرة - العدد الثالث والعشرون- (ابريل – يونيو ) 2006 .

...
تنشيط المبيعات في الأسواق اليمنية ( دراسة ميدانية ) أنس عبدالباسط عباس

 تنشيط المبيعات في الأسواق اليمنية ( دراسة ميدانية ) مجلة دراسات يمنية – مركز الدراسات والبحوث اليمني – العدد ( 79 ) –  ( أكتوبر – ديسمبر ) 2005.

...
دوافع العمل في القطاع النفطي اليمني ( دراسة ميدانية ) أنس عبدالباسط عباس

دوافع العمل في القطاع النفطي اليمني ( دراسة ميدانية ) مجلة شؤون العصر – المركز اليمني للدراسات الإستراتيجية – السنة الثامنة - العدد السادس عشر – ( يوليو – سبتمبر ) – 2004 .

...
المنتجات الجديدة في الأسواق اليمنية وكيفية تفعيلها أنس عبدالباسط عباس

- المنتجات الجديدة في الأسواق اليمنية وكيفية تفعيلها - مجلة الدراسات الاجتماعية – جامعة العلوم والتكنولوجيا المجلد ( 9  ) العدد ( 17 ) - (يناير - يونيو ) – 2004 .

...
- اتخاذ القرارات الإدارية بين النظرية والتطبيق في منظمات القطاع العام والخاص أنس عبدالباسط عباس

- اتخاذ القرارات الإدارية بين النظرية والتطبيق في منظمات القطاع العام والخاص ( دراسة مقارنة ) مجلة حضرموت للدراسات والبحوث – جامعة حضرموت – المجلد الثاني – العدد الخامس – ديسمبر 2003.

...
- واقع تخطيط الموارد البشرية وفاعلية تحقيق الأهداف أنس عبدالباسط عباس

- واقع تخطيط الموارد البشرية وفاعلية تحقيق الأهداف في المنظمات التربوية ( دراسة ميدانية في مديرية التربية بمحافظة حلب ) مجلة الإداري / متخصصة في العلوم الإدارية / معهد الإدارة العامة - سلطنة عُمان العدد 119 – السنة الحادية والثلاثون 1431هـ 2009م .

...
Wave Propagation in Layered Media under Initial Stresses محمود محمد سليم صالح

A.M. El-Naggar and M. M.  Selim “ Wave Propagation in Layered Media

         under Initial Stresses, “ Applied Mathematics and Computation, New York,

...
Rayleigh Wave Dispersion in Flat-Layered Media محمود محمد سليم صالح

Theoretical study and data analysis of surface wave dispersion are one of
the key elements of seismology . In this paper, FORTRAN programs,
DISPER80, of Saito (1986) are used to compute phase and group velocities in
flat-layered media. Dispersion curve of group velocity of Rayleigh waves
between Ankara station,Turkey (Antolpz) and epicenter of 1980/01/14 event is
derived by moving window analysis for the long period record of NEIC data.
By the comparison between the calculated and observed dispersion curves , it is
concluded that B-model of Aswan crustal structures (R.M.Kebeasy et al, 1991)
is consistent with the dispersion better than C-model.

...
Statistical Investigation of Reservoir-Induced Seismicity in Aswan area, Egypt محمود محمد سليم صالح
Propagation and attenuation of seismic body waves in dissipative medium under initial and couple stresses محمود محمد سليم صالح
Plane strain deformation of an initially stressed orthotropic elastic medium محمود محمد سليم صالح

M. M. Selim and M. K. Ahmed. " Plane strain deformation of an  initially 

            stressed orthotropic elastic medium," Appl. Math. Comput. Amsterdam,

            Netherlands, Vol. 175 (1) 221-237(2006).

...
orthotropic elastic medium under the effect of initial and couple stresses محمود محمد سليم صالح

M. M. Selim." orthotropic elastic medium under the effect of  initial  and

           couple stresses," Appl. Math. Comput. Amsterdam, Netherlands, Vol. 181    

           (1) 185- 192 (2006).

...
Propagation of torsional surface waves in heterogeneous half- space with irregular free surface محمود محمد سليم صالح

M. M. Selim. " Propagation of torsional surface waves in heterogeneous half-

           space  with irregular free surface," Applied Mathematical Sciences ,Vol.

           1,no.29,1429-1437 (2007).

...
Torsional waves propagation in an initially stressed dissipative Cylinder محمود محمد سليم صالح

M. M. Selim. "Torsional waves propagation in an initially stressed dissipative

         Cylinder". Applied Mathematical Sciences ,Vol. 1,no.29,1419-1427 (2007).

...
Static deformation of an irregular initially stressed medium محمود محمد سليم صالح

"Static deformation of an irregular initially stressed medium," Appl.

          Math. Comput., Amsterdam, Netherlands, (2007) Vol. 188 (2) 1274-1284.

...
Effect of irregularity on Static deformation of elastic half-space محمود محمد سليم صالح

In the present paper, the problem of two-dimensional static deformation of an isotropic
elastic half-space of irregular thickness has been studied using the eigenvalue approach,
following a Fourier transform. The irregularity is expressed by a rectangular shape. As
an application, the normal line-load acting inside an irregular isotropic half-space has
been considered. Further, the results for the displacements have been derived in the
closed form. To examine the effect of irregularity, variations of the displacements with
horizontal distance have been shown graphically for different values of irregularity size,
and they are compared with those for the medium with uniform shape. It is found that
irregularity affects the deformation significantly.

...
Reflection of Plane Waves at Free Surface of an Initially Stressed Dissipative Medium محمود محمد سليم صالح

The paper discuses the effect of initial stresses on the reflection coefficients of plane
waves in a dissipative medium. Basic governing equations are formulated in context of Biot's
incremental deformation theory. These governing equations are solved analytically to obtain the
dimensional phase velocities of plane waves propagating in plane of symmetry. Closed-form
expressions for the reflection coefficients of P and SV waves incident at the free surface of an initially
stressed dissipative medium are obtained. Numerical computations, using these expressions, are carried
out for a particular model. Computations made with the results predicted in presence and absence of the
initial stresses and the results have been shown graphically. The study shows that the presence of
compressive initial stresses increases the velocity of longitudinal wave (P-wave) but diminishes that of
transverse wave (SV-wave). Also the numerical results presented indicate that initial stresses might
effect the reflection coefficients in a dissipative medium significantly.

...
Effects of initial compression stress on wave propagation in carbon nanotubes محمود محمد سليم صالح

An analytical method to investigate wave propagation in single- and double- walled carbon
nanotubes under initial compression stress is presented. The nanotube structures are treated within the
multilayer thin shell approximation with the elastic properties taken to be those of the graphene sheet. The
governing equations are derived based on Fl¨ugge equations of motion. Frequency equations of wave propagation
in single and double wall carbon nanotubes are described through the effects of initial compression
stress and van der Waals force. To show the effects of Initial compression stress on the wave propagation
in nanotubes, the symmetrical mode can be analyzed based on the present elastic continuum model. It is
shown that the wave speed are sensitive to the compression stress especially for the lower frequencies.

...
Statistical investigation of prevalence of smoking among rural primary and secondary school students in Aflaj area, Kingdom of Saudi Arabia محمود محمد سليم صالح

Objective A school survey was conducted in twelve preparatory and secondary
schools in Aflaj governorate , Kingdom of Saudi Arabia in the academic year 2005-
2006 in order to assess the students’ knowledge, attitudes and practice toward
smoking. Methods An anonymous self-administered questionnaire was used. A total
of 1696 students were interviewed. Results The response rate was 100%. The
prevalence of ever tried cigarette was 10% (154 students) with a median age of
initiation at 17 years of age. About 4%(63 students) from the smoker's students have
stopped smoking. This study examined how perceptions of student smoking in the
school environment and the actual smoking rate among senior students at a school are
related to smoking onset. Multilevel Logistic Regression analysis was used to
examine correlates of ever smoking in the sample. The influence of family members,
teachers and neighbors on smoking status was studied. Fathers’, mothers’ and
brothers’ smoking was found not to be significantly related to students smoking
status. On studying the effect of having a smoker teacher or neighbor on students
smoking, having a smoker neighbor increases the risk of student one and half time
(OR=1.63, 95%CI=1-2.4) while students having a teacher smoking have almost one
the risk of smoking than the others students (OR= 1.2, 95% CI=0.8-1). Conclusions
This investigation show most of students (83%) thought that smoking has health,
economic and social harmful. Also, 84% of students thought that there is a relation
between smoking and drugs and fire as well.. The religious factor play...

Torsional vibration of carbon nanotubes under initial compression stress محمود محمد سليم صالح

This study examines torsional vibration of Single-walled carbon nanotubes (SWCNTs) subjected to initial compression
stresses. The nanotube structures are treated within the multilayer thin shell approximation with the
elastic properties taken to be those of the graphene sheet. Simplified Fl¨ugge shell equations of motion are proposed
as the governing equations of vibration for the carbon nanotubes. A new equation of motion and phase
velocity of torsional waves propagating in carbon nanotubes (CNTs) subjected to initial compression stresses
have been derived. The study reveals that the initial stresses present in the tube has a notable effect on the
propagation of torsional waves. The results has been discussed and shown graphically. This investigation is
very significant for potential application and design of nanoelectronics and nanodevices.

...
Vibrational analysis of pre-stressed carbon nanotubes” Journal of Actaphysica محمود محمد سليم صالح

In this paper an analytical method to investigate vibrational analysis of double-walled carbon nanotubes
under initial compression stress. Simplified Flügge shell equations of motion are proposed as the governing
equations of vibration for the carbon nanotubes. The nanotube structures are treated within the multilayer thin
shell approximation with the elastic properties taken to be those of the graphene sheet. Vibration frequency
equations in double wall carbon nanotubes are described through the effects of initial compression stresses. We
investigate the influence of initial compression stress on the vibrational characteristics of carbon nanotubes based
on the proposed theoretical approach. In this study, we consider the double-walled nanotubes with an inner
diameter of 2.2 nm and an outer diameter of 3.0 nm. The theoretical investigation may give a useful reference for
potential application and design of nanoelectronics and nanodevices

...
Dispersion of dilatation wave propagation in single-wall carbon nanotubes using nonlocal scale effects محمود محمد سليم صالح

Nonlocal continuum mechanics allows
one to account for the small length scale effect that
becomes significant when dealing with micro- or
nano-structures. This paper investigates a model of
wave propagation in single-wall carbon nanotubes
(SWCNTs) with small scale effects are studied. The
equation of motion of the dilatation wave is obtained
using the nonlocal elastic theory. We show that a
dispersive wave equation is obtained from a nonlocal
elastic constitutive law, based on a mixture of a local
and a nonlocal strain. The SWCNTs structures are
treated within the multilayer thin shell approximation
with the elastic properties taken to be those of the
graphene sheet. The SWCNT was the (40,0) zigzag
tube with an effective diameter of 3.13 nm. Non-
linear frequency equations of wave propagation in
SWCNTs are described through the effect of small
scale. The phase velocity and the group velocity are
derived, respectively. The nonlinear dispersion rela-
tion is analyzed with different wave numbers versus
scale coefficient. It can be observed from the results
that the dispersion properties of the dilatation wave
are induced by the small scale effects, which will
disappear in local continuous models. The dispersion
degree can be strengthened by increasing the scale
coefficient and the wave number. Furthermore, the
characteristics for the group velocity of the dilatation
wave in carbon nanotubes can also be tuned by these
factors.

...
Topological Variable Precision Rough Set Model عبدالفتاح عبدالله عزام

Topological generalization of rough sets (RS) and variable precision rough set model (VP-model) are applied together to get a new approach for basic RS concepts. Some examples are given. Properties of the suggested approximations are obtained and a comparison between the new concepts and some similar approximation are given.

...
Topological Application on VP-Model عبدالفتاح عبدالله عزام

Using a nonstandard method for classification of objects, a topological structure is constructed and used to get new types of approximations.  Basic concepts of topological variable precision rough set model are applied to information systems to get reductions and decision rules. We give a detailed explanation for case study in the process of chemical data analysis.

...
Application to Variable Precision Rough Set Model عبدالفتاح عبدالله عزام

Rough set (RS) model can be generalized by adding variable precision model(vp-model) which aimed at solving problems involving uncertain or imprecise information, is presented. An example of the rough set theory application to the quantitative structure activity relationship classification problem is presented. Numerous earlier applications of rough set theory to the various scientific domains suggest that it also can be useful for the analysis of inexact or vague chemical data.

...
ROUGH SET THEORY FOR TOPOLOGICAL SPACES عبدالفتاح عبدالله عزام

The topology induced by binary relations with variable precision

is used to generalize the basic rough set concepts. The suggested topological

structure opens up the way for applying a rich amount of topological facts

and methods in the press of granular computing, in particular, the notion of

topological membership functions is introduced that integrates the concepts of

rough and fuzzy sets.

...
Dispersion of Transverse waves propagation in pre-stressed single-wall carbon nanotubes using nonlocal scale effects محمود محمد سليم صالح

Nonlocal continuum mechanics allows one to account for the small length scale effect that becomes significant when dealing with micro- or nano-structures. This study investigates a model of transverse waves propagating in pre-stressed single-wall carbon nanotubes (SWCNTs) with small scale effects. The equation of motion of the transverse waves will be obtained using the nonlocal elastic theory. We will derive the dispersive wave equation from a nonlocal elastic constitutive law, based on a mixture of a local and a nonlocal strain. The SWCNTs structures will be treated within the multilayer thin shell approximation with the elastic properties taken to be those of the graphene sheet. Nonlinear frequency equations of wave propagation in SWCNTs will be described through the effect of small scale. The phase velocity and the group velocity will be derived, respectively. The nonlinear dispersion relation will be analyzed with different wave numbers versus scale coefficient. It will be expected that the dispersion properties of the transverse waves will be induced by the small scale effects, which will disappear in local continuous models. The dispersion degree can be strengthened by increasing the scale coefficient and the wave number. Furthermore, the characteristics for the group velocity of the transverse waves in carbon nanotubes can also be tuned by these factors.

...
Dispersion of dilatation wave propagation in single-wall carbon nanotubes under initial stress using nonlocal scale effects محمود محمد سليم صالح

In this paper we extend our previous work to show that there is an effect of initial stress on the dilatation wave propagation in single-wall carbon nanotubes. The nanotube structures are treated within the multilayer thin shell approximation with the elastic properties taken to be those of the graphene sheet. The equation of motion of the dilatation wave is obtained using the nonlocal elastic theory. The phase velocity and the group velocity are derived, respectively. The dispersion relation is analyzed with different wave numbers, scale coefficients and initial stress parameter. It can be observed from the results that the dispersion properties of the dilatation wave are induced by small scale effects, which will disappear in local continuous models. The dispersion degree can be strengthened by increasing the scale coefficient and the wave number. In particular, the group velocity of dilatation wave are sensitive to initial compression stress for higher frequencies and insensitive for lower frequencies. The investigation presented may be helpful in the application of CNTs, such as ultrahigh- frequency resonators, electron emission devices, high-frequency oscillators and mechanical sensors.

...
THE REASONS BEHIND STUDENTS’ DISINTEREST IN محمود محمد سليم صالح

The number of Mathematics majors is dropping across the Kingdom of Saudi Arabia. Possible

reasons include an incorrect perception of what mathematics Scientists do and the students’

disinterest due to a lack of familiarity with the subject. The reasons may be different for males and

females. Improving student performance in mathematics is the focus of considerable attention in Saudi

Kingdom state. Identifying the reasons behind the students reluctance to specialize in mathematics is

essential to introduce some suggested solutions so as to find a way to reduce this phenomenon in Al-

Kharj university and Kingdom of Saudi Arabia as well. In order to assess the students’ knowledge,

attitudes and practice toward students’ disinterest in Math as a major in Al-Kharj university, a survey

was conducted in students and instructors of Community and Sciences colleges in Al-Kharj university

in the academic year 2010-2011. In this study, we will restrict ourself for the Community and Sciences

colleges to reduce the cost and because we couldn't perform it in more colleges in this stage. An

anonymous self-administered questionnaire was used. A total of 400 students were interviewed. The

response rate was 74 %. To better understand the reasons behind students’ disinterest in Math as a

major at Community and Science colleges, the students surveyed are not representative mathematical

department in the university-wide. Survey also, involved some teachers and students from high

schools at Al-Aflaj area. The survey results provided evidence to support the belief that students

choose not to major in mathematics...

معجزات الرسول( صلى الله عليه وسلم) في الجمادات والحيوانات في ضوء السنة النبوية بالأدلة و الاثبات عزه محمد بلول جاد الله بلول جاد الله

المقدمة

الحمد لله ذى الجلال والاكرام والفضل والانعام ذى المنن والعطايا الجسام حمدا يوافي ما تزايد من النعم وشكرا يجلب الاحسان والنعم فهو أهل الثناء والكرم , أحمده حمد الشاكرين الابرار وأشكره شكر الصابرين جل ثناؤه وعز سلطانه وعظم جاهه واصلي وأسلم على نبينا وسيدنا وقدوتنا أفضل خلق الله بلا نزاع فهو بدر التمام ومصباح الظلام , الشفيع المشفع يوم الرجفة والازدحام فهو الرحمة المهداة والنعمة المسداة ذو المناقب الفاخرة والأخلاق الطاهرة والمعجزات الباهرة كيف لا وقد قال الله في حقه :(وما ينطق عن الهوى )(إن هو إلا وحي يوحى).(1)

نفعنا الله بمحبته فى الدنيا والاخرة فهو سيد الاولين والاخرين صلى الله عليه بعدد خلقه اجمعين الى يوم الدين.

أما بعد:

فان الادلة على أن محمدا صلى الله عليه وسلم رسول الله حقا كثيرة ومتعددة ومتشعبة الجوانب منها صفاته صلى الله عليه وسلم الخلقية وبكفي أن الله سبحانه قال في محكم تنزيله :((وانك لعلى خلق عظيم)) (2).

ومن دلائل نبوته كذلك ثمرات دعوته من حبث وصولها الى العالم باجمعه فلا توجد قارة من قارات العالم الا وبلغتها رسالته وامن بها فريق من الناس, وما حدث في الدنمارك من حملة اعلامية ضد رسول الانسانية ما هي الادعوة لكل من يسمع بهذا النبي بأن يدخل في الاسلام وما زال النصارى واليهود والوثنيون يقبلون على هذا الدين الاسلامي في كل زمان ومكان.

ومن دلائل صدق رسالة محمد صلى الله علبه وسلم بشارات الانبياء السابقين له بظهوره وأحواله وصفاته ويكفينا هنا قول الله عز وجل على لسان عيسى عليه السلام(( ومبشرا برسول يأتى من بعدي اسمه احمد)) (3).

(1) سورة النجم الآية (3) و(4).

(2) سورة القلم الآية (4).

(3) سورة الصف الآية...

معجزات الرسول( صلى الله عليه وسلم) فى بركة الأطعمة والأشربة فى ضوء السنة النبوية المشرفة عزه محمد بلول جاد الله بلول جاد الله

المقدمة

الحمد لله ذى الجلال والاكرام والفضل والانعام ذى المنن والعطايا الجسام حمدا يوافي ما تزايد من النعم وشكرا يجلب الاحسان والنعم فهو أهل الثناء والكرم , أحمده حمد الشاكرين الابرار وأشكره شكر الصابرين جل ثناؤه وعز سلطانه وعظم

جاهه واصلي وأسلم على نبينا وسيدنا وقدوتنا أفضل خلق الله بلا نزاع فهو بدر التمام ومصباح الظلام , الشفيع المشفع يوم الرجفة والازدحام فهو الرحمة المهداة والنعمة المسداة ذو المناقب الفاخرة والأخلاق الطاهرة والمعجزات الباهرة كيف لا وقد قال الله في حقه :(وما ينطق عن الهوى )(إن هو إلا وحي يوحى).(1)

نفعنا الله بمحبته فى الدنيا والاخرة فهو سيد الاولين والاخرين صلى الله عليه بعدد خلقه اجمعين الى يوم الدين.

أما بعد:

فان الادلة على أن محمدا صلى الله عليه وسلم رسول الله حقا كثيرة ومتعددة ومتشعبة الجوانب منها صفاته صلى الله عليه وسلم الخلقية وبكفي أن الله سبحانه قال في محكم تنزيله :((وانك لعلى خلق عظيم)) (2).

ومن دلائل نبوته كذلك ثمرات دعوته من حبث وصولها الى العالم باجمعه فلا توجد قارة من قارات العالم الا وبلغتها رسالته وامن بها فريق من الناس, وما حدث في الدنمارك من حملة اعلامية ضد رسول الانسانية ما هي الادعوة لكل من يسمع بهذا النبي بأن يدخل في الاسلام وما زال النصارى واليهود والوثنيون يقبلون على هذا الدين الاسلامي في كل زمان ومكان.

ومن دلائل صدق رسالة محمد صلى الله علبه وسلم بشارات الانبياء السابقين له بظهوره وأحواله وصفاته ويكفينا هنا قول الله عز وجل على لسان عيسى عليه السلام(( ومبشرا برسول يأتى من بعدي اسمه احمد)) (3).

(1) سورة النجم الآية (3) و(4).

(2) سورة القلم الآية (4).

(3) سورة الصف الآية (6).

ومن...

معجزات الرسول (صلى الله عليه وسلم) الطبية في ضؤ السنة النبوية عزه محمد بلول جاد الله بلول جاد الله

المقدمة

الحمد لله ذي الجلال والإكرام والفضل والإنعام ذي المنن والعطايا الجسام حمداً يوافي ما تزايد من النعم وشكراً يجلب الإحسان والنعم فهو أهل الثناء والكرم، أحمده حمد الشاكرين وأشكره شكر الصابرين جل ثناؤه وعز سلطانه وعظم جاهه وأصلي وأسلم على نبينا وسيدنا وقدوتنا أفضل خلق الله بلا نزاع فهو بدر التمام ومصباح الظلام، الشفيع المشفع يوم الرجفة والازدحام فهو الرحمة المهداة والنعمة المسداه ذو المناقب الفاخرة والأخلاق الطاهرة والمعجزات الباهرة كيف لا وقد قال الله في حقه: {وَمَا يَنطِقُ عَنِ الْهَوَى }{إن هو إلا وحي يوحى }.(1)

نفعنا الله بمحبته في الدنيا وآلاخرة فهو سيد الأولين والآخرين صلى الله عليه بعدد خلقه أجمعين إلى يوم الدين.

أما بعد:ـ

فإن الأدله على أن محمداً صلى الله عليه وسلم رسول الله حقاً كثيرة ومتعددة ومتشعبة الجوانب منها صفاته صلى الله عليه وسلم الخُلقية ويكفي أن الله سبحانه حدثنا في محكم تنزيله قال تعالى: {وإنك لعلى خلق عظيم } (2)

ومن دلائل نبوته كذلك ثمرات دعوته من حيث وصولها إلى العالم بأجمعه فلا توجد قارة من قارات العالم إلا وبلغتها رسالته وآمن بها فريق من الناس وما حدث في الدنمارك من حملة إعلامية ضد رسول الإنسانية ما هي إلا دعوة لكل من يسمع بهذا النبي بأن يدخل في الإسلام ومازال النصارى واليهود والوثنيون يقبلون على هذا الدين الإسلامي في كل زمان ومكان.

ومن دلائل صدق رسالة محمد صلى الله عليه وسلم. بشارات الأنبياء السابقين له بظهوره وأحواله وصفاته ويكفينا هنا قول الله عز وجل على لسان عيسى

عليه السلام {وَمُبَشِّراً بِرَسُولٍ يَأْتِي مِن بَعْدِي اسْمُهُ أَحْمَدُ }(3).

ومن أعظم دلائل صدق الرسول صلى الله عليه وسلم المعجزات التي أجراها على...

(Automatic Categorization for Improving Arabic to English Language Machine Translation Tool (2013/ 9/2 عبدالعزيز حسن خرساني سليمان

— Machine translation is the study of designing systems that translate from one human language into another. There are many studies discussed the topic, but in-principle there are many obstacles to automatizing the translation process, and the most important of them is the choice of the correct meaning of the target language word . This paper describes a hybrid commercial Preprocessing Stemming Algorithm (HCPSA) for improving the performance of Arabic corpus to English Language Machine translation. We achieved improvements in classification process of about 97% by expert evaluation.

...
MODERN HIGH-EFFICIENCY AUTOMATIC CATEGORIZATION ALGORITHM FOR ARABIC CORPUS ) Vol. 2, Issue 3, July 2013, 137-152) عبدالعزيز حسن خرساني سليمان
Text categorization is the process of classifying documents into a predefined set of categories based on the content of the documents. Many studies have discussed the topic, but in principle there are many obstacles to automatizing the categorization process. This paper describes a hybrid commercial preprocessing stemming algorithm to improve the accuracy of the stemming method. The effectiveness of different methods in the Arabic text categorization process is evaluated, and the most suitable methods for the Arabic language are chosen. We achieve improvements of about 96% in the classification process by human expert evaluation. This tool is found to be essential in automatizing the categorization process, because Arabic versions are needed for development and usage purposes. ...
M.Sc. Thesis: ( Defining of Multiple Byte Integers). March 2004) عبدالعزيز حسن خرساني سليمان

This work is creating or defining a multiple byte integer .Defining such type of integer enables us to create large integer (an integer of about 300 or more decimal digits). The objective of defining such type is to applied it in the generating of public keys used in crypto –system such as RSA

...
الهدي النبوي في تغيير الاسماء عزه محمد بلول جاد الله بلول جاد الله

المقدمة

الحمد لله الذي شرع الدين و أعلنه , و أوضح السبيل و علمه , ووضع لكل شيء حكمة و بينه فأضاء للبشرية ظلمات قلوبها , و أحيا موات نفوسها , و الصلاة و السلام على الهادي البشير النذير الذي فصل في القرآن ما أجمل و وضح منه ما أبهم , و لم يقبضه الله حتى أكمل له الدين و أتم عليه النعمة و رضي له الإسلام دينا و رضي الله عن آله و صحابته الأطهار الطيبين الذين حفظ الله بهم هذا الدين فرضي الله عنهم و عن تابعيهم و تابع تابعيهم الذين فقهوا الكتاب و السنة و أقوال الصحابة الكرام و جاهدوا في الله حق جهاده في سبيل حفظ الدين و كتابه حتى أوصلوه لنا نقياً واضحاً جلياً .

و بعد :

فإن الله سبحانه و تعالى خلق الأنسان من سلالة من طين ثم جعله نطفة في قرارٍ مكين ثم خلق النطفة علقة للناظرين ثم خلق العلقة مضغة أي قطعة لحم ثم خلق المضغة عظاما أساسا يقوم عليه هذا البناء المتبنثم كسا العظام لحماً هو لها كالثوب ثم أنشأه خلقاً آخر فتبارك الله أحسن الخالقين

قال تعالى ( يَهَبُ لِمَنْ يَشَاء�إِنَاثًا�وَيَهَبُ لِمَن يَشَاء�الذُّكُورَ� ) سورة الشورى الآية (49)

إن الله سبحانه و تعالى نوع أحكامه على الإنسان منذ أن كانت نطفة أمر الملك يكتب رزقه و أجله و شقي أو سعيد ثم تنوعت الأحكام تبعاً لما سبق من حين خروجه إلى الدنيا إلى حين يستقر في دار القرار و في هذه الفترة تتعلق به أحكام عديدة و المخاطب بها الأبوين أو من يقوم مقامها في تربيته...

معجزات الرسول صلى الله عليه وسلم في سرعة استجابة الدعاء عزه محمد بلول جاد الله بلول جاد الله

المقدمة

الحمد لله ذى الجلال والاكرام والفضل  والانعام ذى المنن والعطايا الجسام حمدا يوافي ما تزايد من النعم وشكرا يجلب الاحسان والنعم فهو أهل الثناء والكرم , أحمده حمد الشاكرين الابرار وأشكره شكر الصابرين جل ثناؤه وعز سلطانه وعظم جاهه واصلي وأسلم على نبينا وسيدنا وقدوتنا أفضل خلق الله بلا نزاع فهو بدر التمام ومصباح الظلام , الشفيع المشفع يوم الرجفة والازدحام فهو الرحمة المهداة والنعمة المسداة ذو المناقب الفاخرة والأخلاق الطاهرة والمعجزات الباهرة كيف لا وقد قال الله في حقه :(وما ينطق عن الهوى )(إن هو إلا وحي يوحى).(1)

نفعنا الله بمحبته فى الدنيا والاخرة  فهو سيد الاولين والاخرين صلى الله عليه بعدد خلقه اجمعين الى يوم الدين.

أما بعد:

فان الادلة على أن محمدا صلى الله عليه وسلم رسول الله حقا كثيرة ومتعددة ومتشعبة الجوانب منها صفاته صلى الله عليه وسلم الخلقية وبكفي أن الله سبحانه قال في محكم تنزيله :((وانك لعلى خلق عظيم)) (2).

ومن دلائل نبوته كذلك ثمرات دعوته من حبث وصولها الى العالم باجمعه فلا توجد قارة من قارات العالم الا وبلغتها رسالته وامن بها فريق من الناس, وما حدث في الدنمارك من حملة اعلامية ضد رسول الانسانية ما هي الادعوة لكل من يسمع بهذا النبي بأن يدخل في الاسلام وما زال النصارى واليهود والوثنيون يقبلون على هذا الدين الاسلامي في كل زمان ومكان.

ومن دلائل صدق رسالة محمد صلى الله علبه وسلم بشارات الانبياء السابقين له بظهوره وأحواله وصفاته ويكفينا هنا قول الله عز وجل على لسان عيسى عليه السلام(( ومبشرا برسول يأتى من بعدي اسمه احمد)) (3).

ومن أعظم دلائل صدق...

Non-local correlation and quantum discord in two atoms in the non-degenerate model عبدالباسط عبدالحميد محمد

By using geometric quantum discord (GQD) and measurementinduced
nonlocality (MIN), quantum correlation is investigated for
two atoms in the non-degenerate two-photon Tavis–Cummings
model. It is shown that there is no asymptotic decay for MIN
while asymptotic decay exists for GQD. Quantum correlations can
be strengthened by introducing the dipole–dipole interaction. The
evolvement period of quantum correlation gets shorter with the
increase in the dipole–dipole parameter. It is found that there
exists not only quantum nonlocality without entanglement but
also quantum nonlocality without quantum discord. Also, the MIN
and GQD are raised rather than entanglement, and also with weak
initial entanglement, there are MIN and entanglement in a interval
of death quantum discord.

...
Pairwise correlations via quantum discord and its geometric measure in a four-qubit spin chain عبدالباسط عبدالحميد محمد

The dynamic of pairwise correlations, including quantum entanglement (QE) and discord
(QD) with geometric measure of quantum discord (GMQD), are shown in the four-qubit Heisenberg
XX spin chain. The results show that the effect of the entanglement degree of the initial
state on the pairwise correlations is stronger for alternate qubits than it is for nearest-neighbor
qubits. This parameter results in sudden death for QE, but it cannot do so for QD and GMQD.
With different values for this entanglement parameter of the initial state, QD and GMQD differ
and are sensitive for any change in this parameter. It is found that GMQD is more robust than both
QD and QE to describe correlations with nonzero values, which offers a valuable resource for quantum
computation.

...
Influence of the phase damping for two-qubits system in the dispersive reservoir عبدالباسط عبدالحميد محمد

Ananalytical solution of the master equation for two qubits-field system in
the dispersive reservoir are investigated, the qubits are initially in werner states. Under
the influence of the damping we investigate the quantum correlation in a two-qubit
based on measurement-induced disturbance (MID). We compare MID and entanglement
measured by negativity and illustrate their different characteristics. We find the
effect of damping on MID is weaker than negativity. Negativity will experience a
sudden transition but this will not happen for MID.

...
Quantum logic gates generated by SC-charge qubits coupled to a resonator عبدالباسط عبدالحميد محمد

We propose some quantum logic gates by using SC-charge qubits coupled to
a resonator to study two types of quantum operation. By applying a classical
magnetic field with the flux, a simple rotation on the target qubit is generated.
Single and two-qubit gates of quantum logic gates are realized. Two-qubit joint
operations are firstly generated by applying a classical magnetic field with the
flux, and secondly by applying a classical magnetic field with the flux when
qubits are placed a quarter of the distance along the resonator.Ashort discussion
of fidelity is given to prove the success of the operations in implementing these
gates.

...
Pairwise quantum correlations of a three-qubit XY chain with phase decoherence عبدالباسط عبدالحميد محمد

Quantum correlations, including entanglement and discord with its geometric
measure in a three-qubit Heisenberg XY chain, with phase decoherence, are
investigated when a nonuniform magnetic field is applied. When the qubits are initially
in an unentangled state, the nearest neighbor pairwise correlations are destroyed
by phase decoherence, but stationary correlations appear for next-to-neighbor qubits.
With an inhomogeneous magnetic field, the stationary correlations appear for nearest
neighbor qubits and they disappear for next-to-nearest neighbor qubits. But when the
qubits are initially in an entangled state, an inhomogeneous magnetic field can enhance
the stationary correlations of next-to-neighbor qubits, but it cannot do so for nearest
neighbor qubits

...
Control of purity and entanglement for two spatially two-separated qubits via the phase damping عبدالباسط عبدالحميد محمد

Control of purity and entanglement of two two-qubits dispersively coupled to a ¯eld with a reservoir are investi-
gated. Initially the qubits are entangled while the ¯eld is either in coherent state or statistical mixture of two coherent
states. For an alternative entanglement measure we calculate the negativity of the eigenvalues of the partially trans-
posed density matrix. A measure related to the mutual entropy namely, index of entropy is employed to measure the
entanglement. Its results agree well with the negativity. It is found that the entanglement and purity have strong
sensitivity to the phase damping.

...
DEATH OF ENTANGLEMENT AND PURITY IN A TWO QUBITS–FIELD SYSTEM INDUCED BY PHASE DAMPING عبدالباسط عبدالحميد محمد

We investigate the death of entanglement and the purity loss of a two qubits–field system in the
dispersive regime with a reservoir. For an alternative entanglement measure, we calculate the negativity
of the eigenvalues of a partially transposed density matrix and compare it with the mutual entropy. A
new measure related to the mutual entropy, namely, the index of entropy, is proposed to measure the
degree of entanglement, and this agrees well with the negativity. We found that the entanglement has
a strong sensitivity to the phase damping. The asymptotic behavior of the field states, the two qubits,
and the total system fall into a mixed state. We treat the phenomena of death of entanglement and
purity as they arise from the effect of phase damping.

...
Quantifying Quantumness with Sudden Birth or Death of Entanglement for Two-Qubits System عبدالباسط عبدالحميد محمد

Quantumness of the correlations between two qubits, coupled to a cavity field
whenever the system is open or closed, is investigated when sudden death (or birth) of the
entanglement occurs. It is found that quantum correlation not exists only in the entangled
state. It’s found that the dephasing parameters and the purity of the initial states play an
important role in the dynamics behaviors of the quantum correlations, including entanglement.
Quantumness of the correlations and entanglement, due to dephasing of the cavity, are
damped until the same their values which are contained in their initial states.

...
Quantum correlation of correlated two qubits interacting with a thermal field عبدالباسط عبدالحميد محمد

The quantum correlation (QC) of two qubits coupled to a thermal field is investigated based on
measurement-induced disturbance. It is found that QC does not exist only in the entangled
state. Due to the thermal parameter, QC is inhibited from vanishing and the phenomenon of
the death and birth of entanglement occurs. Due to the field-mode structure, QC is equal to
zero for separated qubits, whereas for a maximally entangled state, it has a periodic
asymptotic behavior which does not vanish. QC and entanglement differ when the qubit state
is initially in the separated or entangled state.

...
Death of entanglement and non-locality in a superconducting qubit-field entangled state in a thermal reservoir عبدالباسط عبدالحميد محمد

The analytical description of a superconducting qubit strongly coupled to a resonator with a thermal reservoir
is given. Link between nonlocality and entanglement is investigated, they can be manipulated and controlled
by any change in the thermal reservoir parameters. According to the Peres conjecture: if the state has
negative partial transposition, then the violation of Bell's inequality occurs. Under the effect of thermal noise,
the negative partial transposition is transformed to positive. Therefore, the state shows the phenomenon of
sudden death of both entanglement and nonlocality.

...
Entanglementdeathandpuritylossinasuperconductingqubit coupled toadephasingcavity عبدالباسط عبدالحميد محمد

Analyticaldescriptionofthedynamicsofasuperconductingqubitinteractingwitharesonatorcavity
coupledtoitsreservoirispresented.Whenthedetuningbetweenthejunctionenergyandresonator
frequencytakesdifferentvalues,theentanglementdeathandpuritylossareinvestigated.Itisfound
that thedephasingoftheresonatorcavityleadstopersistentpuritylossandentanglementdeathofthe
SC-qubit,theyremainnearlyinvariantregardlessoftheincreaseoftime.Entanglementdeathand
purity losscanbeenhancedwhentheSC-qubitiskeptoff-resonantwiththeresonator.

...
The effect of atomic spontaneous decay on the dynamics of the negativity of the Wigner function of radiation عبدالباسط عبدالحميد محمد

The exact solution of the master equation for the case of a high-Q cavity with atomic decay is found. We use
the negativity of the Wigner function (WF) as an indicator of nonclassicality. It is found that the negative values of
the field WF are very sensitive to any change in the damping parameter. The atomic spontaneous decay leads to the
simultaneous disappearance of both entanglement and nonclassicality of quantum states. Moreover, the purity of the
field states is completely lost.

...
Erasing information and purity of a quantum dot via its spontaneous decay عبدالباسط عبدالحميد محمد

An analytical solution to the master equation of a system describing a single quantum dot confined in a
single-mode microcavity, coupled to its environment, is found. The information loss of the phase space,
the purity and the relaxation process are investigated by using the Husimi distribution and its applications.
It is found that the spontaneous decay leads to the loss of information of the phase space and the purity.
Suggested indicator for the relaxation process is offered by using the Wehrl entropy.

...
LOSS OF COHERENCE OF PURE AND MIXED STATES FOR A MULTIMODE RADIATION FIELD INTERACTING NONLINEARLY WITH A QUBIT عبدالباسط عبدالحميد محمد

We study the loss of coherence of pure and mixed states for a nonlinear interaction between the multimode
field and a qubit. We calculate analytically partial entropies of the qubit and field subsystems,
which are used to measure the loss of coherence. We find that the loss of coherence loss is sensitive to
the initial field states, the number of modes, and the nonlinear-interaction parameter.

...
Asymptotic geometric phase and purity for phase qubit dispersively coupled to lossy LC circuit عبدالباسط عبدالحميد محمد

Analytical descriptions of the geometric phases (GPs) for the total
system and subsystems are studied for a current biased Josephson
phase qubit strongly coupled to a lossy LC circuit in the dispersive
limit. It is found that, the GP and purity depend on the damping
parameter which leads to the phenomenon of GP death. Coherence
parameter delays the phenomenon of a regular sequence of deaths
and births of the GP. The asymptotic behavior of the GP and the
purity for the qubit-LC resonator state closely follow that for the
qubit state, but however, for the LC circuit these asymptotic values
are equal to zero.

...
ENTANGLEMENT DEATH AND PURITY LOSS FOREVER IN THE DISPERSIVE INTERACTION OF A TRAPPED ION AND LIGHT WITHOUT ENERGY RELAXATION عبدالباسط عبدالحميد محمد

Death of entanglement between light and the vibrational motion of a single trapped ion in the
dispersive regime with a reservoir is investigated. It is found that with phase-damped cavity, the
purity of the light-motional states is lost forever, unlike the purity of the ion's internal states
which have regular patterns and they do not decay. The asymptotic behavior of the states of the
light, the ion-motional and the total system fall into a mixed state. The entanglement and purity
have strong sensitivity to the phase damping and the ionic distribution angle. The entanglement
sudden death has been treated as it arises from the e®ect of phase damping on mixed as well as
pure states.

...
Entanglement sudden death of a SC-qubit strongly coupled with a quantized mode of a lossy cavity عبدالباسط عبدالحميد محمد

The dynamics of entanglement and mixedness of a superconducting qubit strongly coupled
to a cavity field induced by a cavity damping governed by a master equation are
investigated. It is found that, asymptotic decays as well as finite time disentanglement
depend on the parameter of the dissipation, which leads to the existence of the
entanglement sudden death.

...
Long-time death of nonclassicality of a cavity field interacting with a charge qubit and its own reservoir عبدالباسط عبدالحميد محمد

A measure of nonclassicality of quantum states based on the negative values of the Wigner function
(WF) of a charge qubit-field system is proposed. It is found that, the negative values of the field WF are
very sensitive to any change in dissipation parameter. The dissipation leads to a long-time death for both
entanglement and nonclassicality, and also the coherence of the cavity state is lost completely.

...
Effect of atomic spontaneous decay on entanglement in the generalized Jaynes–Cummings model عبدالباسط عبدالحميد محمد

 Some aspects of the irreversible dynamics of a generalized Jaynes–
Cummings model are addressed. By working in the dressed-state
representation, it is possible to split the dynamics of the entanglement
and coherence. The exact solution of the master equation in
the case of a high-Q cavity with atomic decay is found. Effects of
the atomic spontaneous decay on the temporal evolution of partial
entropies of the atom or the field and the total entropy as a quantitative
measure entanglement are elucidated. The degree of entanglement,
through the sum of the negative eigenvalues of the
partially transposed density matrix and the negative mutual information
has been studied and compared with other measures.

...
Output entanglement from SU(1, 1) coherent states under nonlinear dissipation in the dispersive limit عبدالباسط عبدالحميد محمد

An analytical solution is found for the master equation of a system described
by a nonlinear Jaynes–Cummings model, in the presence of nonlinear quantum
dissipation at zero temperature in the large detuning approximation. We study
the influence of nonlinear quantum dissipation on the output entanglement
dynamics of the atom–field system, considering the field to be initially in
SU(1, 1) coherent states. It is found that in the presence of the nonlinear
quantum dissipation, the amplitude of the output entanglement between the
field and the atom decreases with time, however the entanglement between the
field–atom system and the environment increases with time.

...
Invariant dynamicsofasuperconductingqubitstronglycoupledtoacavity field withoutenergyrelaxation عبدالباسط عبدالحميد محمد

MotivatedbyrecentexperimentswhereintheCooperboxcanbeusedtoprobethedecayofthe
resonatorsuperpositionstateduetoenvironmentaldecoherence.Wetheoreticallyinvestigatethe
dynamicsofentanglementandmixednessofasuperconductingqubitstronglycoupledtoacavityfield
inducedbyaphase-dampingreservoirgovernedbyamasterequation.Withaphase-damping,the
amountoftheentanglementandthemixednessoftheglobalsystemandoftheresonatorstateshave
invariantdynamicswhilephasedampinghasnoeffectonthedynamicofthedegreeofthemixedness

...
Effects of cavity damping on the entanglement for a three-level atomic system عبدالباسط عبدالحميد محمد

Based on the master equation for the density matrix, the dynamics of the entanglement of the three-level atom
interacting with single-mode field in a finite-Q cavity are studied. It was found that the cavity damping leads to
growing entropy and a strong degradation of the entanglement, therefore the coherence loss and entanglement is
very sensitive to any change in the cavity damping parameter.

...
Entropy and Entanglement in Master Equation of Effective Hamiltonian for Jaynes–Cummings Model عبدالباسط عبدالحميد محمد

In this paper, we analytically solve the master equation for Jaynes–Cummings model in the dispersive
regime including phase damping and the field is assumed to be initially in a superposition of coherent states. Using an
established entanglement measure based on the negativity of the eigenvalues of the partially transposed density matrix
we find a very strong sensitivity of the maximally generated entanglement to the amount of phase damping. Qualitatively
this behavior is also reflected in alternative entanglement measures, but the quantitative agreement between different
measures depends on the chosen noise model. The phase decoherence for this model results in monotonic increase in the total entropy while the atomic sub-entropy keeps its periodic behaviour without any effect.

...
Influence of Phase Damping on the Entanglement for the Damped JC Model in the Pure and Mixed States عبدالباسط عبدالحميد محمد

In this article, we investigate the effects of phase damping on the temporal evolution of different
entanglement measurements and the amount of entanglement for the damped Jaynes–Cummings model. The
master equation is solved for any initial state in the two-level atom. Superpositions of two coherent states (
π/2or π out of phase) and their statistical mixture state are taken as initial states when a phase-damped cavity is
taken into account.

...
Effect of phase-damped cavity on dynamics of tangles of a nondegenerate two-photon JC mode عبدالباسط عبدالحميد محمد

A two-mode cavity field coupled to a two-level atom and damped by the environment through a phasedamped
process is considered. For a chosen initial state, the effects of phase damping on the purity loss of
the global system and different bipartite partitions of the system (atom–two modes, mode–(atom–
mode)) through the tangles are considered. In particular, the effect of phase damping on the amount
of entanglement between atom and field is evaluated by the negativity.

...
Entropy and entanglement in the Jaynes–Cummings model with effects of cavity damping عبدالباسط عبدالحميد محمد

atom via intensity-dependent coupling in the off-resonant case has been studied, where the
leakage of photon through the cavity is taken into account. The effects of cavity damping on
the coherence properties of the atom and the field are studied. The amount of entanglement is
compared with the total correlations. It is found that the atom–field system is inhibited from
going into a pure state in the off-resonant case.

...
Entanglement and Its Dynamics with Atomic Spontaneous Decay عبدالباسط عبدالحميد محمد

CHIN.PHYS.LETT. Vol. 25, No. 7 (2008) 2492

H. A. Hessian∗, A. -B. A. Mohamed
Faculty of Science, Assiut University, Assiut, Egypt
 
The atomic decay for a two-level atom interacting with a single mode of electromagnetic field is considered. For a
chosen initial state, the exact solution of the master equation is found. Therefore, effect of the atomic damping on
entanglement (purity loss), degree of entanglement by the negativity, mutual information and atomic coherence
through the master equation are studied.

...
The effects of thermal photons on entanglement dynamics for a dispersive Jaynes–Cummings model عبدالباسط عبدالحميد محمد

cavity. The effects of thermal photons ( ¯n = 0) on entanglement and coherence loss are investigated. It is found that the field is inhibited from going into a pure state and coherence is lost faster than in the case of zero temperature ( ¯n = 0).

...
Combined Effect of Dissipation and Thermal Mixed State on Entanglement in the Dispersive Limit عبدالباسط عبدالحميد محمد

We investigate the entanglement in the interacting system of a single mode thermal field and a single qubit
with dissipation in the dispersive limit. The influence of initial temperature of thermal field and atoms on the
entanglement is then examined.

...
Effects of Atomic Motion on the Entropies and Entanglement for a JC Model with a Mixed State Input عبدالباسط عبدالحميد محمد

In this article, we study the effects of the atomic motion and the field-mode structure on
the entropies and entanglement of a generalized JC model. We have investigated different
forms of the intensity dependent function on the evolution of the entropies and entanglement
in the case of a coherent superposition state and a statistical mixture of coherent states as
the initial field states. We investigate the partial entropy of the atom and field subsystems
numerically. The setting of the initial state of the field-mode and the atomic motion plays
an important role in the evolution of the sub-entropies and entanglement.

...
Entropy and entanglement in the mixed state for a dispersive JC model in a phase-damped cavity عبدالباسط عبدالحميد محمد

Temporal evolution is studied for total entropy, the entropy difference and the sum of negative eigenvalues of the partially transposed density matrix as quantitative entanglement measurements for JC model in a phase-damped cavity in the dispersive approximation. The cavity field is assumed to be coupled to a reservoir with a phase-damping coupling. The case of a statistical mixture (SM) of coherent states is considered as initial field state. The effects of cavity phase damping on the entanglement between the field and the atom are
studied.

...
Entropies and entanglement for decoherence without energy relaxation in a two-level atom عبدالباسط عبدالحميد محمد

degree of entanglement and total correlation of a single-mode light field
interacting with a two-level atom. The phase-damped cavity is taken into
account. The effects of phase damping on a temporal of partial entropies
for the atom and the field, total entropy, the entropy difference and the
sum of negative eigenvalues of the partially transposed density matrix as a
quantitative entanglement measure for the master equation in the dressed-state
approximation are taken into account

...
Entropies and Entanglement for Initial Mixed State in the Multi-quanta JC Model with the Stark Shift and Kerr-like Medium عبدالباسط عبدالحميد محمد

In this paper, we study the time evolution of the entropies and the degree of entanglement
in the mixed state for a multi-quanta JC model taking into consideration Stark shift and
Kerr-like medium effect, we use a numerical method to investigate the time evolution
of the partial entropy of the atom and field subsystem. This is done in the framework of
themulti-quanta presses JCmodel with both the Stark shift and Kerr-likemedium effect
added. Furthermore, we examine the effect of the superposition states and a statistical
mixture of coherent states as an initial field on the entropies and entanglement. Our
results show that the setting of the initial state play an important role in the evolution
of the sub-entropies and entanglement.

...
استئجار الأرحام نايف عمار الدوسري
الحمد لله عالم الغيب والشهادة وهو الحكيم الخبير،القائل( هو الذي يصوركم في الأرحام كيف يشاء لا إله إلا هو العزيز الحكيم  )([1])،لا يعزب عنه مثقال ذرة في السموات ولا في الأرض خلق الإنسان أطوارا لحكم يعلمها قال –تعالى- : (وقد خلقكم أطوارا)([2]) ،وقال: (يا أيها الناس إن كنتم في ريب من البعث فإنا خلقناكم من تراب ثم من نطفة ثم من علقة ثم من مضغة مخلقة وغير مخلقة لنبين لكم ونقر في الأرحام ما نشاء إلى أجل مسمى )([3]) ،والصلاة والسلام على نبيه محمد القائل: (إن أحدكم يجمع خلقه في بطن أمه أربعين يومانطفة، ثم علقة مثل ذلك، ثم يكون مضغة مثل ذلك ....)([4])الحديث.       أما بعد:    فإن العصر الحديث يعتبر عصر النهوض العلمي والمد الثقافي الهائل ،واكتشاف المجهول ،لم تنحبس فيه المعلومة لتكون متقوقعة في حيز واحد ، يحتويها زمان أومكان دون الآخر، ولم تتوقف فيه الدراسات العلمية والعملية على جانب دون آخر، بل كانت الرؤية العلمية أوضح من كل ذلك حيث تغلغلت ؛ ليغزو العقل البشري بما هيأ الله له من وسائل جبارة كل نطاق المجهول التي سمح الله باختراقها، وكان مما تقدم فيه العلم المعاصر تقدما ساحقا علم الأرحام والأجنة فخاضه الإنسان بذلك الإشعاع الرباني الذي زوده الله به -ألا وهو العقل - فجاءت النتائج نتائج مذهلة تجعل الإنسان يستحضر دائما نفوذ قدرة الله -فسبحانك اللهم وبحمدك -. حقا ، لقد بلغ هذا العلم أوجه حتى تعرض لبحوث أكاديمية عميقة ذات قدر علمي رصين وتناول الباحثون جزئياته بالدراسة والربط والتحليل  ،ومن مسائله ذات الأهمية مسألة استئجار...
الاجتهاد في معالجة النوازل الفقهية المعاصرة نايف عمار الدوسري

 

الحمد لله رب العالمين والعاقبة للمتقين ولا عدوان إلا على الظالمين والصلاة والسلام على أشرف المرسلين وعلى آله وصحبه أجمعين . أما بعد :   فإن الشريعة الإسلامية جاءت بكل ما يصلح الناس في أمور دينهم ودنياهم ، فالقرآن والسنة بها الحياة الحقيقة كما قال سبحانه : (وَكَذَلِكَ أَوْحَيْنَا إِلَيْكَ رُوحاً مِنْ أَمْرِنَا مَا كُنْتَ تَدْرِي مَا الْكِتَابُ وَلا الْإيمَانُ وَلَكِنْ جَعَلْنَاهُ نُوراً نَهْدِي بِهِ مَنْ نَشَاءُ مِنْ عِبَادِنَا وَإِنَّكَ لَتَهْدِي إِلَى صِرَاطٍ مُسْتَقِيمٍ) ([1]) . فاشتملا على قواعد وأصول عامة يرجع الناس إليها في كثير من الحوادث فيجتهد العلماء في استنباط الأحكام من خلالها الذي يعتبر ضرورة شرعية لابد من الأخذ به لمواجهة الوقائع والمتغيرات ، والمسلمون أحوج ما يكونوا إلى الاجتهاد في هذا العصر لحدوث مسائل جديدة نظراً لتطور أحوال المجتمعات

 

  ([1]) الشورى آية : 52 . 

 

...
التورق المصرفي نايف عمار الدوسري
  الحمد لله رب العالمين والصلاة والسلام على رسول الله وعلى آله وصحبه وسلم   وبعد : فهذا بحث يسير حول مسألة التورق وهو من الموضوعات الهامة في هذا العصر، وقد استفدت كثيرا مما كتبه الدكتور :خالد بن علي المشيقح في مجلة البحوث الإسلامية العدد (  73  ) بعنوان " التورق المصرفي عن طريق بيع المعادن " ، وفي هذه الكتابة المتواضعة لاأدعي الكمال بل النقص ظاهر ، والتقصير حاصل ، وعذري كثرة النوازع وحسبي أن ي أعطيت صورة واضحة ونتيجة مثمره والله المستعان وعليه التكلان  ...
الفرق بين عورة الرجل والمرأة نايف عمار الدوسري

الحمد لله والصلاة والسلام على رسول الله وآله وصحبه ومن والاه واتبع هداه  أما بعد :

فإن الشريعة الإسلامية شريعة بالغة الكمال لم تترك شيئا من أفعال المكلفين إلا وقد قررت فيه الحكم الإلهي الذي لا يمكن المحيد عليه بحال من الأحوال فما من سلوك من سلوكيات البشر إلا وقد وضعت له حدودا لا يجوز تعديها ولا مجاوزتها ، ومن تلك السلوكيات التي لم تتركها الشريعة الإسلامية للعواطف البشرية للبت فيها قضية البصر وحدود استعماله فقد فصلت فيه الشريعة وبينت جميع الأحكام المتعلقة بهذا الجانب من السلوك وكما ومن هنا اخترت هذا البحث لتجلية ما يتعلق بتحديد عورة الرجل وعورة المرأة والفرق بينهما في نظر هذه الشريعة الغراء الخالدة لعل الله ينفع به وسميته الفرق بين عورة الرجل وعورة المرأة وقد توخيت فيه الاختصار والإيجاز ، ولاأدعي الكمال بل فيه قصور كبير ومواطن الخلل متعددة ، لكثرة المشاغل وقلة الوقت ، كما أنبه ومن الأمانة العلمية أني اعتمت على كتاب : أحكام العورة والنظر للدكتور مساعد الفالح ، وكتاب : النظر وأحكامه للدكتور :عبدالله بن عبد المحسن الطريقي ، والموسوعة الفقهية الكويتية ، والباقي بطريق الواسطة  ...
المسح على الخفين نايف عمار الدوسري

الحمد لله رب العالمين والصلاة والسلام على رسول الله  وبعد :

فإنه لا يخفى ما للفقه في الدين من مكانة في الإسلام ،انبثقت  من كونه يعتمد على الأصلين الذين هما ركيزتا الدين كتاب  الله ،وسنة رسول الله -صلى الله عليه وسلم-

وقد انحصرت أهميته في قول الناطق بجوامع الكلم نبينا محمد - صلى الله عليه وسلم - حيث قال: (من يرد الله به خيرا يفقهه في الدين )([1]) ومن نظر في مسائله وجد أنها تختلف من حيث تشعب كلام العلماء فيها واختلافهم في جزئياتها، ومن  تلك المسائل التي نالت قسطا غير يسير من تداول العلماء  لها، ليس في الفقه فحسب، بل صارت محكا للأنظار في كتب العقائد بما يخصها: مسألة" المسح على الخفين" ،ومن هنا اقتضت الأهمية التي أشرنا إليها أن دراستها ستظل في قائمة أولويات طالب الفقه في كل زمان ومكان 0   ([1])أخرجه البخاري في صحيحه برقم (71) 1/164، ومسلم برقم (1037) 2/718

 

...
بطاقة الائتمان -حقيقتها-حكمها نايف عمار الدوسري

الحمد لله رب العالمين والصلاة والسلام على أشرف المرسلين وبعد : فإن فقه المعاملات المالية من أهم المواضيع التي يحتاج إليها المسلم في هذا الزمان ،بشكل لم يشهد له التاريخ مثيل ، فتنوعت في الشكل والمضمون .

ومن هذه المعاملات ما يخص المصارف ، حيث كثرت الدعاية لها ، وغلفت بأغلفة براقة وبأسماء جذابة ، فسموها بغير اسمها لجذب العملاء . ومن هذه المعاملات ما يسمى بـ (بطاقة الائتمان) فلا تكاد تتصفح صحيفة ، ولاتمر بممر في مدينة إلا وتجد الدعاية لها ،فتهافت عليها بعض ضعاف النفوس وتسارعوا إليها. وفي هذا البحث المتواضع نلقي الضوء على هذه المعاملة ،ببيان حقيقتها، كما في المصارف اليوم ، ثم الحكم عليها. ...
الإسلام وعلم البحار (البيئة البحرية أنموذجا) نايف عمار الدوسري
  الحمدلله والصلاة والسلام على رسول الله    وبعد:  إن الإسلام قد شارك في عمارة الأرض وسبق كل النظم المعاصرة في كثير من نواحي الحياة الاجتماعية والاقتصادية والسياسة والطبيعية، ومن هذه الجوانب (البيئة)، حيث أمر الإسلام بالمحافظة عليها، وقد أبرز كثير من الباحثين هذا الجانب، ولعل من البيئات المهمة البيئة البحرية التي سأبسط الحديث فيها قاصدا تسليط الضوء على عناية الإسلام بها، وإبراز الجانب الفقهي حيالها، وقد يظن غير الدارسين للإسلام أن النظم المعاصرة قد أتت بما لم يكن معروفا من قبل، وفي هذه الورقات اليسيرة أبين النظام العالمي الذي جاء به الإسلام قبل اتفاقية الأمم المتحدة. ...
شكسبير الحائر بين الترجمات العربية Said Ahmed Aboudaif

...
ماهية الخطأ محمد علي الكبيري

      

...
Aspects of Radical Feminism in the Fiction of the 21st Century (A Theoretical Study) Said Ahmed Aboudaif

An Abstract

This study is a theoretical investigation of radical feminism theory. First, the study aims at presenting feminism as a literary critical approach and elaborates through the works of some feminist writers. The patriarchal society and female reality is examined to explain the difference between the world as men have constructed and the reality that is lived, imagined and expressed by women. This explanation will help to generate a critical background to come up to the fictional world of Alice Walker. The idea of radical feminist theory is defined and developed with reference to patriarchal society. Then, the aspects of radical feminism in Walker’s novels are examined as an example of post-modern literary criticism of the 21st century.

Key Words:literary criticism; Feminism; Radical Feminism; Alice Walker

...
Quasi-Probability Distribution Functions for a Single Trapped Ion Interacting with a Mixed Laser Field عبدالباسط عبدالحميد محمد

We give a fully analytical description of the dynamics of the quasi-probability distribution (Q-PD)
functions for any model describing a single two-level qubit interacting with a field. The Wigner function at time
(t= 0) and Q-function for a pure state as an initial field state are studied. But, in this paper, the temporal behavior
of the Q-PD functions for a coherent superposition state (SS) and a statistical mixture of coherent states (SM)
for the interaction between a single ion and laser field are investigated. It is found that, the temporal behavior
of the Q-PD functions is in very good agreement with its counterpart for the entanglement. If the curve of the
entanglement between the trapped ion (specially for the second red sideband) and laser field are known, we can
expect the shape of the Q-PD functions.

...
Sub-entropies and phase properties undergoing the effects of atomic motion for the Jaynes–Cummings model with initial mixed state input عبدالباسط عبدالحميد محمد

An analytical method to calculate the sub-entropies and entanglement for the mixed 
state as an initial field is presented. Also, we investigate the effects of the atomic motion
and the field-mode structure on sub-entropies and phase properties of the coherent super
position state and a statistical mixture of coherent states as initial field states taking
into account different forms of the intensity-dependent coupling. The initial state, the
atomic motion and the field-mode structure play important roles in the time evolution
of the entropies, entanglement and phase properties.

...
QR Code for https://csha.psau.edu.sa/ar/sources/research/csha.psau.edu.sa